• Gene id: 4880

Gene Summary

• Gene Symbol: NPPC   Gene   UCSC   Ensembl
• Aliases: CNP, CNP2
• Gene name: natriuretic peptide C
• Alternate names: C-type natriuretic peptide, natriuretic peptide precursor type C,
• Gene location: 2q37.1 (231926404: 231921808)     Exons: 4     NC_000002.12
• Gene summary(Entrez): This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the cardiac natriuretic peptides CNP-53, CNP-29 and CNP-22, which belong to the natriuretic family of peptides. The encoded p
• OMIM: 608597

Protein Summary

• Protein general information: P23582  
  • Name: C type natriuretic peptide [Cleaved into: CNP 22; CNP 29; CNP 53]
  • Length: 126  
  • Mass: 13246
  • Tissue specificity: [CNP-22]
• Sequence:

  MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDL
  RVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC

• Structural information:
  • Interpro: IPR002406  IPR000663  IPR030480  
  • Prosite: PS00263
  • PDB: 1JDP
  • PDBsum: 1JDP
  • STRING: ENSP00000387159
• Other Databases: GeneCards:  NPPC  Malacards:  NPPC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051427	hormone receptor binding	IBA	molecular function
GO:0005179	hormone activity	IBA	molecular function
GO:0007168	receptor guanylyl cyclase signaling pathway	IBA	biological process
GO:0006182	cGMP biosynthetic process	IBA	biological process
GO:0007168	receptor guanylyl cyclase signaling pathway	IDA	biological process
GO:0003419	growth plate cartilage chondrocyte proliferation	ISS	biological process
GO:0051427	hormone receptor binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0003418	growth plate cartilage chondrocyte differentiation	ISS	biological process
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0001503	ossification	IEA	biological process
GO:0005179	hormone activity	IEA	molecular function
GO:1900194	negative regulation of oocyte maturation	IDA	biological process
GO:0051447	negative regulation of meiotic cell cycle	IDA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:1903779	regulation of cardiac conduction	TAS	biological process
GO:0005179	hormone activity	IEA	molecular function
GO:0010753	positive regulation of cGMP-mediated signaling	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0003418	growth plate cartilage chondrocyte differentiation	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0022414	reproductive process	IEA	biological process
GO:0051447	negative regulation of meiotic cell cycle	IEA	biological process
GO:1900194	negative regulation of oocyte maturation	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0007168	receptor guanylyl cyclase signaling pathway	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0019934	cGMP-mediated signaling	IEA	biological process
GO:0030141	secretory granule	IEA	cellular component
GO:0032966	negative regulation of collagen biosynthetic process	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045669	positive regulation of osteoblast differentiation	IEA	biological process
GO:0048660	regulation of smooth muscle cell proliferation	IEA	biological process
GO:0097755	positive regulation of blood vessel diameter	IEA	biological process
GO:2000279	negative regulation of DNA biosynthetic process	IEA	biological process
GO:0003419	growth plate cartilage chondrocyte proliferation	IEA	biological process
GO:0006182	cGMP biosynthetic process	IEA	biological process
GO:0009791	post-embryonic development	IEA	biological process
GO:0040014	regulation of multicellular organism growth	IEA	biological process
GO:0048513	animal organ development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006182	cGMP biosynthetic process	IDA	biological process
GO:0006457	protein folding	IDA	biological process
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0032991	protein-containing complex	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04022	cGMP-PKG signaling pathway
hsa04270	Vascular smooth muscle contraction
hsa05418	Fluid shear stress and atherosclerosis

Diseases

Associated diseases	References
Hypertension	PMID:11775888
Hypertension	PMID:12452325
Arteriosclerosis	PMID:8989116
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881