• Gene id: 4869

Gene Summary

• Gene Symbol: NPM1   Gene   UCSC   Ensembl
• Aliases: B23, NPM
• Gene name: nucleophosmin 1
• Alternate names: nucleophosmin, nucleolar protein NO38, nucleophosmin (nucleolar phosphoprotein B23, numatrin), nucleophosmin/nucleoplasmin family, member 1, testicular tissue protein Li 128,
• Gene location: 5q35.1 (35641525: 35599540)     Exons: 7     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is involved in several cellular processes, including centrosome duplication, protein chaperoning, and cell proliferation. The encoded phosphoprotein shuttles between the nucleolus, nucleus, and cytoplasm, chaperoning ribos
• OMIM: 164040

Protein Summary

• Protein general information: P06748  
  • Name: Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin)
  • Length: 294  
  • Mass: 32575
• Sequence:

  MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVT
  LATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSK
  VPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQ
  ESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

• Structural information:
  • Interpro: IPR032569  IPR038101  IPR004301  IPR024057  IPR036824  
  • PDB: 2LLH 2P1B 2VXD 5EHD
  • PDBsum: 2LLH 2P1B 2VXD 5EHD
  • DIP: 30932
  • STRING: ENSP00000296930
• Other Databases: GeneCards:  NPM1  Malacards:  NPM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0042393	histone binding	IBA	molecular function
GO:0042274	ribosomal small subunit biogenesis	IBA	biological process
GO:0042273	ribosomal large subunit biogenesis	IBA	biological process
GO:0006407	rRNA export from nucleus	IBA	biological process
GO:0005813	centrosome	IBA	cellular component
GO:0005730	nucleolus	IBA	cellular component
GO:0005654	nucleoplasm	IBA	cellular component
GO:0003682	chromatin binding	IBA	molecular function
GO:0000056	ribosomal small subunit export from nucleus	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0010824	regulation of centrosome duplication	IBA	biological process
GO:0006338	chromatin remodeling	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0000055	ribosomal large subunit export from nucleus	IBA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:1902751	positive regulation of cell cycle G2/M phase transition	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045727	positive regulation of translation	IDA	biological process
GO:0044387	negative regulation of protein kinase activity by regulation of protein phosphorylation	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0006281	DNA repair	IDA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0060735	regulation of eIF2 alpha phosphorylation by dsRNA	IDA	biological process
GO:0060699	regulation of endoribonuclease activity	IDA	biological process
GO:0032071	regulation of endodeoxyribonuclease activity	IDA	biological process
GO:0004860	protein kinase inhibitor activity	IDA	molecular function
GO:0046599	regulation of centriole replication	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0043024	ribosomal small subunit binding	IDA	molecular function
GO:0043023	ribosomal large subunit binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0034080	CENP-A containing nucleosome assembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0001046	core promoter sequence-specific DNA binding	IDA	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0032993	protein-DNA complex	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0033613	activating transcription factor binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0034644	cellular response to UV	IDA	biological process
GO:0051082	unfolded protein binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0031616	spindle pole centrosome	IDA	cellular component
GO:0006334	nucleosome assembly	IDA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0042393	histone binding	IDA	molecular function
GO:0005813	centrosome	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0051059	NF-kappaB binding	IDA	molecular function
GO:0006913	nucleocytoplasmic transport	IDA	biological process
GO:0003723	RNA binding	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0030957	Tat protein binding	IDA	molecular function
GO:0008104	protein localization	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0007569	cell aging	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005925	focal adhesion	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0010826	negative regulation of centrosome duplication	IMP	biological process
GO:0007098	centrosome cycle	IMP	biological process
GO:1902629	regulation of mRNA stability involved in cellular response to UV	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	NAS	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0005634	nucleus	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0042255	ribosome assembly	TAS	biological process
GO:0006913	nucleocytoplasmic transport	TAS	biological process
GO:0006886	intracellular protein transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Chronic myelomonocytic leukemia	KEGG:H02411
Chronic myelomonocytic leukemia	KEGG:H02411
acute myeloid leukemia	PMID:25992555
acute myeloid leukemia	PMID:24184354
acute myeloid leukemia	PMID:15659725
acute myeloid leukemia	PMID:17957027
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881