• Gene id: 4857

Gene Summary

• Gene Symbol: NOVA1   Gene   UCSC   Ensembl
• Aliases: Nova-1
• Gene name: NOVA alternative splicing regulator 1
• Alternate names: RNA-binding protein Nova-1, neuro-oncological ventral antigen 1, onconeural ventral antigen 1, paraneoplastic Ri antigen, ventral neuron-specific protein 1,
• Gene location: 14q12 (26598032: 26443089)     Exons: 10     NC_000014.9
• Gene summary(Entrez): This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic
• OMIM: 136130

Protein Summary

• Protein general information: P51513  
  • Name: RNA binding protein Nova 1 (Neuro oncological ventral antigen 1) (Onconeural ventral antigen 1) (Paraneoplastic Ri antigen) (Ventral neuron specific protein 1)
  • Length: 507  
  • Mass: 51727
  • Tissue specificity: Brain.
• Sequence:

  MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTGEDGQYFLKVLIPSYAAGSIIGKGGQTIVQL
  QKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRIKQT
  LPSSPTTTKSSPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTVSG
  EPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLPTAAAAAGLLGHANLAGVAAF
  PAVLSGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAAAAASANPAAAAANLLATYASEASASGST
  AGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQEL
  TGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG

• Structural information:
  • Protein Domains: (49..11-)
    (/note="KH-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117-)
    (171..23-)
    (/note="KH-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117-)
    (421..48-)
    (/note="KH-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117"-)
  • Interpro: IPR004087  IPR004088  IPR036612  IPR033086  
  • Prosite: PS50084
  • PDB: 1DT4 2ANN 2ANR
  • PDBsum: 1DT4 2ANN 2ANR
  • STRING: ENSP00000438875
• Other Databases: GeneCards:  NOVA1  Malacards:  NOVA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003729	mRNA binding	IBA	molecular function
GO:0000398	mRNA splicing, via spliceosome	IBA	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IBA	biological process
GO:0010468	regulation of gene expression	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IEA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	TAS	molecular function
GO:0008380	RNA splicing	TAS	biological process
GO:0006396	RNA processing	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0007626	locomotory behavior	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0120163	negative regulation of cold-induced thermogenesis	IEA	biological process
GO:0003730	mRNA 3'-UTR binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0051252	regulation of RNA metabolic process	IEA	biological process
GO:0003729	mRNA binding	IEA	molecular function
GO:0000398	mRNA splicing, via spliceosome	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:0045202	synapse	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray