• Gene id: 4856

Gene Summary

• Gene Symbol: CCN3   Gene   UCSC   Ensembl
• Aliases: IBP-9, IGFBP-9, IGFBP9, NOV, NOVh
• Gene name: cellular communication network factor 3
• Alternate names: CCN family member 3, IGF-binding protein 9, insulin-like growth factor-binding protein 9, nephro blastoma-overexpressed gene protein homolog, nephroblastoma overexpressed, nephroblastoma-overexpressed gene protein homolog, protein NOV homolog,
• Gene location: 8q24.12 (119416445: 119424433)     Exons: 5     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal develop
• OMIM: 104260

Protein Summary

• Protein general information: P48745  
  • Name: CCN family member 3 (Cellular communication network factor 3) (Insulin like growth factor binding protein 9) (IBP 9) (IGF binding protein 9) (IGFBP 9) (Nephro blastoma overexpressed gene protein homolog) (Protein NOV homolog) (NovH)
  • Length: 357  
  • Mass: 39162
  • Tissue specificity: Expressed in endiothelial cells (at protein level) (PubMed
• Sequence:

  MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESC
  SDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLL
  PEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFS
  TRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRC
  CTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM

• Structural information:
  • Protein Domains: (32..10-)
    (/note="IGFBP-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00653-)
    (108..17-)
    (/note="VWFC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00220-)
    (205..25-)
    (/note="TSP-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:-)
  • Interpro: IPR006207  IPR006208  IPR009030  IPR000867  IPR012395   IPR017891  IPR000884  IPR036383  IPR001007  
  • Prosite: PS01185 PS01225 PS00222 PS51323 PS50092 PS01208 PS50184
  • STRING: ENSP00000259526
• Other Databases: GeneCards:  CCN3  Malacards:  CCN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008201	heparin binding	IBA	molecular function
GO:0007155	cell adhesion	IBA	biological process
GO:0005178	integrin binding	IBA	molecular function
GO:0060548	negative regulation of cell death	IBA	biological process
GO:0031012	extracellular matrix	IBA	cellular component
GO:0007165	signal transduction	IBA	biological process
GO:0033627	cell adhesion mediated by integrin	IDA	biological process
GO:0033627	cell adhesion mediated by integrin	IDA	biological process
GO:0010761	fibroblast migration	IDA	biological process
GO:0060326	cell chemotaxis	IDA	biological process
GO:0045747	positive regulation of Notch signaling pathway	IDA	biological process
GO:0014909	smooth muscle cell migration	IDA	biological process
GO:0048659	smooth muscle cell proliferation	IDA	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:0071603	endothelial cell-cell adhesion	IDA	biological process
GO:0010832	negative regulation of myotube differentiation	IDA	biological process
GO:0045747	positive regulation of Notch signaling pathway	IDA	biological process
GO:0035767	endothelial cell chemotaxis	IDA	biological process
GO:0046676	negative regulation of insulin secretion	ISS	biological process
GO:0061484	hematopoietic stem cell homeostasis	IMP	biological process
GO:0030308	negative regulation of cell growth	IMP	biological process
GO:0005576	extracellular region	ISS	cellular component
GO:1904057	negative regulation of sensory perception of pain	ISS	biological process
GO:0090027	negative regulation of monocyte chemotaxis	IMP	biological process
GO:1990523	bone regeneration	ISS	biological process
GO:0060392	negative regulation of SMAD protein signal transduction	ISS	biological process
GO:0005112	Notch binding	IPI	molecular function
GO:0044342	type B pancreatic cell proliferation	ISS	biological process
GO:0005737	cytoplasm	IMP	cellular component
GO:0005921	gap junction	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0005921	gap junction	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1901223	negative regulation of NIK/NF-kappaB signaling	IMP	biological process
GO:0050728	negative regulation of inflammatory response	ISS	biological process
GO:1902731	negative regulation of chondrocyte proliferation	IMP	biological process
GO:0002062	chondrocyte differentiation	IMP	biological process
GO:0005178	integrin binding	IPI	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005520	insulin-like growth factor binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0005921	gap junction	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002062	chondrocyte differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005921	gap junction	IEA	cellular component
GO:0010468	regulation of gene expression	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0044342	type B pancreatic cell proliferation	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:1904057	negative regulation of sensory perception of pain	IEA	biological process
GO:0046676	negative regulation of insulin secretion	IEA	biological process
GO:0048659	smooth muscle cell proliferation	IEA	biological process
GO:0060392	negative regulation of SMAD protein signal transduction	IEA	biological process
GO:1990523	bone regeneration	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005921	gap junction	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Pre-eclampsia	PMID:16675545
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881