• Gene id: 4852

Gene Summary

• Gene Symbol: NPY   Gene   UCSC   Ensembl
• Aliases: PYY4
• Gene name: neuropeptide Y
• Alternate names: pro-neuropeptide Y, prepro-neuropeptide Y,
• Gene location: 7p15.3 (180980384: 181063426)     Exons: 10     NC_000002.12
• Gene summary(Entrez): This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neurope
• OMIM: 162640

Protein Summary

• Protein general information: P01303  
  • Name: Pro neuropeptide Y [Cleaved into: Neuropeptide Y (Neuropeptide tyrosine) (NPY); C flanking peptide of NPY (CPON)]
  • Length: 97  
  • Mass: 10851
  • Tissue specificity: One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.
• Sequence:

  MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLIS
  DLLMRESTENVPRTRLEDPAMW

• Structural information:
  • Interpro: IPR001955  IPR020392  
  • Prosite: PS00265 PS50276
  • CDD: cd00126
  • PDB: 1QFA 1RON
  • PDBsum: 1QFA 1RON
  • STRING: ENSP00000384364
• Other Databases: GeneCards:  NPY  Malacards:  NPY

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	ISS	cellular component
GO:0032100	positive regulation of appetite	ISS	biological process
GO:0008343	adult feeding behavior	ISS	biological process
GO:0005179	hormone activity	IBA	molecular function
GO:0007631	feeding behavior	IBA	biological process
GO:0001664	G protein-coupled receptor binding	IBA	molecular function
GO:0005184	neuropeptide hormone activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0031175	neuron projection development	IEP	biological process
GO:0021954	central nervous system neuron development	IEP	biological process
GO:0021987	cerebral cortex development	IEP	biological process
GO:0098992	neuronal dense core vesicle	ISS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005184	neuropeptide hormone activity	TAS	molecular function
GO:0005246	calcium channel regulator activity	TAS	molecular function
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0007631	feeding behavior	TAS	biological process
GO:0005623	obsolete cell	TAS	cellular component
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008217	regulation of blood pressure	IEA	biological process
GO:0001664	G protein-coupled receptor binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0098992	neuronal dense core vesicle	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0060575	intestinal epithelial cell differentiation	TAS	biological process
GO:0045202	synapse	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04024	cAMP signaling pathway
hsa05034	Alcoholism
hsa04920	Adipocytokine signaling pathway
hsa04923	Regulation of lipolysis in adipocytes

Diseases

Associated diseases	References
Peripheral artery disease	PMID:21468772
Alzheimer's disease	PMID:8592643
Hypertension	PMID:11689216
Visual epilepsy	PMID:19038255
Huntington's disease	PMID:24121255
Dementia	PMID:2903567
Mental depression	PMID:14757324
Childhood absence epilepsy	PMID:17331209
Anxiety disorder	PMID:22328461
Arteriosclerosis	PMID:11689216
Temporal lobe epilepsy	PMID:18477594
type 2 diabetes mellitus	PMID:15926114
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray