• Gene id: 4850

Gene Summary

• Gene Symbol: CNOT4   Gene   UCSC   Ensembl
• Aliases: CLONE243, NOT4, NOT4H
• Gene name: CCR4-NOT transcription complex subunit 4
• Alternate names: CCR4-NOT transcription complex subunit 4, CCR4-associated factor 4, E3 ubiquitin-protein ligase CNOT4, NOT4 (negative regulator of transcription 4, yeast) homolog, RING-type E3 ubiquitin transferase CNOT4, potential transcriptional repressor NOT4Hp,
• Gene location: 7q33 (135510126: 135361794)     Exons: 14     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is a subunit of the CCR4-NOT complex, a global transcriptional regulator. The encoded protein interacts with CNOT1 and has E3 ubiquitin ligase activity. Several transcript variants encoding different isoforms have been fou
• OMIM: 604911

Protein Summary

• Protein general information: O95628  
  • Name: CCR4 NOT transcription complex subunit 4 (EC 2.3.2.27) (CCR4 associated factor 4) (E3 ubiquitin protein ligase CNOT4) (Potential transcriptional repressor NOT4Hp) (RING type E3 ubiquitin transferase CNOT4)
  • Length: 575  
  • Mass: 63510
• Sequence:

  MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEEL
  QRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYA
  GSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTK
  EEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTP
  SPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFT
  SETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPG
  SGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLD
  LNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA

• Structural information:
  • Protein Domains: (109..18-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR034261  IPR039780  IPR039515  IPR012677  IPR035979   IPR000504  IPR003954  IPR000571  IPR001841  IPR013083  
  • Prosite: PS50102 PS50103 PS50089
  • CDD: cd16618 cd12438
  • PDB: 1E4U 1UR6
  • PDBsum: 1E4U 1UR6
  • STRING: ENSP00000445508
• Other Databases: GeneCards:  CNOT4  Malacards:  CNOT4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004842	ubiquitin-protein transferase activity	IBA	molecular function
GO:0016567	protein ubiquitination	IBA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0045652	regulation of megakaryocyte differentiation	IDA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0030014	CCR4-NOT complex	IDA	colocalizes with
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004842	ubiquitin-protein transferase activity	IEA	molecular function
GO:0030014	CCR4-NOT complex	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881