• Gene id: 4848

Gene Summary

• Gene Symbol: CNOT2   Gene   UCSC   Ensembl
• Aliases: CDC36, HSPC131, IDNADFS, NOT2, NOT2H
• Gene name: CCR4-NOT transcription complex subunit 2
• Alternate names: CCR4-NOT transcription complex subunit 2, CCR4-associated factor 2, negative regulator of transcription 2,
• Gene location: 12q15 (70242992: 70355256)     Exons: 21     NC_000012.12
• Gene summary(Entrez): This gene encodes a subunit of the multi-component CCR4-NOT complex. The CCR4-NOT complex regulates mRNA synthesis and degradation and is also thought to be involved in mRNA splicing, transport and localization. The encoded protein interacts with histone
• OMIM: 604909

Protein Summary

• Protein general information: Q9NZN8  
  • Name: CCR4 NOT transcription complex subunit 2 (CCR4 associated factor 2)
  • Length: 540  
  • Mass: 59738
  • Tissue specificity: Ubiquitous. Highly expressed in brain, heart, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocytes. {ECO
• Sequence:

  MVRTDGHTLSEKRNYQVTNSMFGASRKKFVEGVDSDYHDENMYYSQSSMFPHRSEKDMLASPSTSGQLSQFGASL
  YGQQSALGLPMRGMSNNTPQLNRSLSQGTQLPSHVTPTTGVPTMSLHTPPSPSRGILPMNPRNMMNHSQVGQGIG
  IPSRTNSMSSSGLGSPNRSSPSIICMPKQQPSRQPFTVNSMSGFGMNRNQAFGMNNSLSSNIFNGTDGSENVTGL
  DLSDFPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKS
  NLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQVLPDGRVTNIPQGMVTDQFGMIGLLTFIRAAETDPGMVH
  LALGSDLTTLGLNLNSPENLYPKFASPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYM
  NGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERP
  HLPSTFNYNPAQQAF

• Structural information:
  • Interpro: IPR038635  IPR040168  IPR007282  
  • PDB: 4C0D 4C0F 5FU6 5FU7
  • PDBsum: 4C0D 4C0F 5FU6 5FU7
  • DIP: 42656
  • STRING: ENSP00000229195
• Other Databases: GeneCards:  CNOT2  Malacards:  CNOT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000932	P-body	IBA	cellular component
GO:0017148	negative regulation of translation	IBA	biological process
GO:0030015	CCR4-NOT core complex	IBA	cellular component
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	IBA	biological process
GO:2000036	regulation of stem cell population maintenance	IBA	biological process
GO:0030014	CCR4-NOT complex	IDA	cellular component
GO:0001226	RNA polymerase II transcription corepressor binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0033147	negative regulation of intracellular estrogen receptor signaling pathway	IMP	biological process
GO:0004535	poly(A)-specific ribonuclease activity	IMP	contributes to
GO:2000036	regulation of stem cell population maintenance	IMP	biological process
GO:0010606	positive regulation of cytoplasmic mRNA processing body assembly	IMP	biological process
GO:0030015	CCR4-NOT core complex	IEA	cellular component
GO:0042025	host cell nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006417	regulation of translation	IEA	biological process
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000036	regulation of stem cell population maintenance	IEA	biological process
GO:0001829	trophectodermal cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0005634	nucleus	NAS	cellular component
GO:0003712	transcription coregulator activity	TAS	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)