• Gene id: 4841

Gene Summary

• Gene Symbol: NONO   Gene   UCSC   Ensembl
• Aliases: MRXS34, NMT55, NRB54, P54, P54NRB, PPP1R114
• Gene name: non-POU domain containing octamer binding
• Alternate names: non-POU domain-containing octamer-binding protein, 54 kDa nuclear RNA- and DNA-binding protein, 55 kDa nuclear protein, DNA-binding p52/p100 complex, 52 kDa subunit, non-POU domain-containing octamer (ATGCAAAT) binding protein, p54(nrb), protein phosphatase 1, ,
• Gene location: Xq13.1 (71283191: 71301167)     Exons: 13     NC_000023.11
• Gene summary(Entrez): This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carc
• OMIM: 300084

Protein Summary

• Protein general information: Q15233  
  • Name: Non POU domain containing octamer binding protein (NonO protein) (54 kDa nuclear RNA and DNA binding protein) (55 kDa nuclear protein) (DNA binding p52/p100 complex, 52 kDa subunit) (NMT55) (p54(nrb)) (p54nrb)
  • Length: 471  
  • Mass: 54232
  • Tissue specificity: Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Also found in a number of breast tumor cell lines. {ECO
• Sequence:

  MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKTFTQRSR
  LFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRFACHSASL
  TVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTVE
  PMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEAREKLEMEM
  EAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQQEEMMRRQQEGFKGTFP
  DAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTERFGQAATMEGIGAIGGT
  PPAFNRAAPGAEFAPNKRRRY

• Structural information:
  • Protein Domains: (74..14-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (148..22-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012975  IPR012677  IPR034552  IPR035979  IPR000504  
  • Prosite: PS50102
  • CDD: cd12588
  • PDB: 3SDE 5IFM
  • PDBsum: 3SDE 5IFM
  • DIP: 29951
  • STRING: ENSP00000276079
• Other Databases: GeneCards:  NONO  Malacards:  NONO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903377	negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0000398	mRNA splicing, via spliceosome	IBA	biological process
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003676	nucleic acid binding	IBA	molecular function
GO:0002218	activation of innate immune response	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0007623	circadian rhythm	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0070888	E-box binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0006310	DNA recombination	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0008380	RNA splicing	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0006397	mRNA processing	TAS	biological process
GO:0008380	RNA splicing	TAS	biological process
GO:0042382	paraspeckles	IDA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0090575	RNA polymerase II transcription regulator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0042752	regulation of circadian rhythm	IEA	biological process
GO:0070888	E-box binding	IEA	molecular function
GO:0007623	circadian rhythm	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0003682	chromatin binding	ISS	molecular function
GO:0090575	RNA polymerase II transcription regulator complex	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016363	nuclear matrix	IDA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Syndromic X-linked mental retardation	KEGG:H00658
Syndromic X-linked mental retardation	KEGG:H00658
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq