• Gene id: 4837

Gene Summary

• Gene Symbol: NNMT   Gene   UCSC   Ensembl
• Gene name: nicotinamide N-methyltransferase
• Alternate names: nicotinamide N-methyltransferase,
• Gene location: 11q23.2 (12686826: 12690957)     Exons: 3     NC_000007.14
• Gene summary(Entrez): N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. [provided by RefSeq, Jul 200
• OMIM: 176940

Protein Summary

• Protein general information: P40261  
  • Name: Nicotinamide N methyltransferase (EC 2.1.1.1)
  • Length: 264  
  • Mass: 29574
  • Tissue specificity: Predominantly expressed in the liver. A lower expression is seen in the kidney, lung, skeletal muscle, placenta and heart. Not detected in the brain or pancreas.
• Sequence:

  MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSAC
  ESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLG
  AVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAV
  KEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL

• Structural information:
  • Interpro: IPR025820  IPR000940  IPR029063  
  • Prosite: PS01100 PS51681
  • PDB: 2IIP 3ROD 5YJF 6B1A 6CHH 6PVE 6PVS
  • PDBsum: 2IIP 3ROD 5YJF 6B1A 6CHH 6PVE 6PVS
  • STRING: ENSP00000441434
• Other Databases: GeneCards:  NNMT  Malacards:  NNMT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0008112	nicotinamide N-methyltransferase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0008170	N-methyltransferase activity	IBA	molecular function
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008112	nicotinamide N-methyltransferase activity	TAS	molecular function
GO:0008112	nicotinamide N-methyltransferase activity	IEA	molecular function
GO:0034356	NAD biosynthesis via nicotinamide riboside salvage pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0008112	nicotinamide N-methyltransferase activity	TAS	molecular function
GO:0030760	pyridine N-methyltransferase activity	TAS	molecular function
GO:0032259	methylation	TAS	biological process
GO:0032259	methylation	IEA	biological process
GO:0008112	nicotinamide N-methyltransferase activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0010243	response to organonitrogen compound	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0031100	animal organ regeneration	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00760	Nicotinate and nicotinamide metabolism

Diseases

Associated diseases	References
renal cell carcinoma	PMID:17070307
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R