• Gene id: 4836

Gene Summary

• Gene Symbol: NMT1   Gene   UCSC   Ensembl
• Aliases: NMT
• Gene name: N-myristoyltransferase 1
• Alternate names: glycylpeptide N-tetradecanoyltransferase 1, alternative, short form NMT-S, long form, NMT-L, myristoyl-CoA:protein N-myristoyltransferase 1, type I N-myristoyltransferase,
• Gene location: 17q21.31 (45061316: 45109015)     Exons: 12     NC_000017.11
• Gene summary(Entrez): Myristate, a rare 14-carbon saturated fatty acid, is cotranslationally attached by an amide linkage to the N-terminal glycine residue of cellular and viral proteins with diverse functions. N-myristoyltransferase (NMT; EC 2.3.1.97) catalyzes the transfer o
• OMIM: 160993

Protein Summary

• Protein general information: P30419  
  • Name: Glycylpeptide N tetradecanoyltransferase 1 (EC 2.3.1.97) (Myristoyl CoA:protein N myristoyltransferase 1) (NMT 1) (Type I N myristoyltransferase) (Peptide N myristoyltransferase 1)
  • Length: 496  
  • Mass: 56806
  • Tissue specificity: Heart, gut, kidney, liver and placenta.
• Sequence:

  MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAKKKKKKQKKKKEKGSETDSAQ
  DQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPY
  TLPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVRVVSSRKLVGF
  ISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRS
  LNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLTRYLKQFHLTPVMSQEEVEHWF
  YPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTHKSLKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVF
  NALDLMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ

• Structural information:
  • Interpro: IPR016181  IPR000903  IPR022677  IPR022678  IPR022676  
  • Prosite: PS00975 PS00976
  • PDB: 1RXT 3IU1 3IU2 3IWE 3JTK 4C2Y 4C2Z 5MU6 5NPQ 5O6H 5O6J 5O9S 5O9T 5O9U 5O9V 5UUT 6EHJ 6F56 6FZ2 6FZ3 6FZ5
  • PDBsum: 1RXT 3IU1 3IU2 3IWE 3JTK 4C2Y 4C2Z 5MU6 5NPQ 5O6H 5O6J 5O9S 5O9T 5O9U 5O9V 5UUT 6EHJ 6F56 6FZ2 6FZ3 6FZ5
  • STRING: ENSP00000468424
• Other Databases: GeneCards:  NMT1  Malacards:  NMT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004379	glycylpeptide N-tetradecanoyltransferase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0018008	N-terminal peptidyl-glycine N-myristoylation	IBA	biological process
GO:0019898	extrinsic component of membrane	IDA	cellular component
GO:0004379	glycylpeptide N-tetradecanoyltransferase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0018008	N-terminal peptidyl-glycine N-myristoylation	IDA	biological process
GO:0004379	glycylpeptide N-tetradecanoyltransferase activity	IEA	molecular function
GO:0006499	N-terminal protein myristoylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004379	glycylpeptide N-tetradecanoyltransferase activity	IEA	molecular function
GO:0022400	regulation of rhodopsin mediated signaling pathway	TAS	biological process
GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006499	N-terminal protein myristoylation	TAS	biological process
GO:0019107	myristoyltransferase activity	TAS	molecular function
GO:0019107	myristoyltransferase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019107	myristoyltransferase activity	IEA	molecular function
GO:0006499	N-terminal protein myristoylation	IEA	biological process
GO:0004379	glycylpeptide N-tetradecanoyltransferase activity	IEA	molecular function
GO:0001701	in utero embryonic development	IEA	biological process
GO:0019107	myristoyltransferase activity	IDA	molecular function
GO:0042180	cellular ketone metabolic process	IDA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq