• Gene id: 4833

Gene Summary

• Gene Symbol: NME4   Gene   UCSC   Ensembl
• Aliases: NDPK-D, NM23H4, nm23-H4
• Gene name: NME/NM23 nucleoside diphosphate kinase 4
• Alternate names: nucleoside diphosphate kinase, mitochondrial, NDK, NDP kinase D, NDP kinase, mitochondrial, NDPKD, non-metastatic cells 4, protein expressed in, nucleoside diphosphate kinase D,
• Gene location: 16p13.3 (396728: 400753)     Exons: 8     NC_000016.10
• Gene summary(Entrez): The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm2
• OMIM: 602716

Protein Summary

• Protein general information: O00746  
  • Name: Nucleoside diphosphate kinase, mitochondrial (NDK) (NDP kinase, mitochondrial) (EC 2.7.4.6) (Nucleoside diphosphate kinase D) (NDPKD) (nm23 H4)
  • Length: 187  
  • Mass: 20659
  • Tissue specificity: Widely distributed. Found at very high levels in prostate, heart, liver, small intestine, and skeletal muscle tissues, and in low amounts in the brain and in blood leukocytes.
• Sequence:

  MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQ
  APESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVI
  HASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA

• Structural information:
  • Interpro: IPR034907  IPR036850  IPR001564  IPR023005  
  • Prosite: PS00469
  • PDB: 1EHW
  • PDBsum: 1EHW
  • STRING: ENSP00000219479
• Other Databases: GeneCards:  NME4  Malacards:  NME4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006163	purine nucleotide metabolic process	IBA	biological process
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0006220	pyrimidine nucleotide metabolic process	IBA	biological process
GO:0004550	nucleoside diphosphate kinase activity	IBA	molecular function
GO:0006228	UTP biosynthetic process	IEA	biological process
GO:0006241	CTP biosynthetic process	IEA	biological process
GO:0004550	nucleoside diphosphate kinase activity	IEA	molecular function
GO:0006165	nucleoside diphosphate phosphorylation	IEA	biological process
GO:0006183	GTP biosynthetic process	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0006869	lipid transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0009117	nucleotide metabolic process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0009116	nucleoside metabolic process	TAS	biological process
GO:0004550	nucleoside diphosphate kinase activity	TAS	molecular function
GO:0005739	mitochondrion	TAS	cellular component
GO:0004550	nucleoside diphosphate kinase activity	IEA	molecular function
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0015949	nucleobase-containing small molecule interconversion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1901612	cardiolipin binding	IDA	molecular function
GO:0006869	lipid transport	IDA	biological process
GO:0005758	mitochondrial intermembrane space	IDA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00230	Purine metabolism
hsa00983	Drug metabolism - other enzymes
hsa00240	Pyrimidine metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq