• Gene id: 4832

Gene Summary

• Gene Symbol: NME3   Gene   UCSC   Ensembl
• Aliases: DR-nm23, NDPK-C, NDPKC, NM23-H3, NM23H3, c371H6.2
• Gene name: NME/NM23 nucleoside diphosphate kinase 3
• Alternate names: nucleoside diphosphate kinase 3, NDK 3, NDP kinase 3, NDP kinase C, non-metastatic cells 3, protein expressed in, nucleoside diphosphate kinase C,
• Gene location: 16p13.3 (1771749: 1770319)     Exons: 5     NC_000016.10
• OMIM: 605452

Protein Summary

• Protein general information: Q13232  
  • Name: Nucleoside diphosphate kinase 3 (NDK 3) (NDP kinase 3) (EC 2.7.4.6) (DR nm23) (Nucleoside diphosphate kinase C) (NDPKC) (nm23 H3)
  • Length: 169  
  • Mass: 19015
• Sequence:

  MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRER
  PFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALW
  FRADELLCWEDSAGHWLYE

• Structural information:
  • Interpro: IPR034907  IPR036850  IPR001564  IPR023005  
  • Prosite: PS00469
  • PDB: 1ZS6
  • PDBsum: 1ZS6
  • DIP: 49960
  • STRING: ENSP00000219302
• Other Databases: GeneCards:  NME3  Malacards:  NME3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006163	purine nucleotide metabolic process	IBA	biological process
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0006220	pyrimidine nucleotide metabolic process	IBA	biological process
GO:0004550	nucleoside diphosphate kinase activity	IBA	molecular function
GO:0006228	UTP biosynthetic process	IEA	biological process
GO:0006241	CTP biosynthetic process	IEA	biological process
GO:0004550	nucleoside diphosphate kinase activity	IEA	molecular function
GO:0006165	nucleoside diphosphate phosphorylation	IEA	biological process
GO:0006183	GTP biosynthetic process	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0009117	nucleotide metabolic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0004550	nucleoside diphosphate kinase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0015949	nucleobase-containing small molecule interconversion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006163	purine nucleotide metabolic process	IBA	biological process
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0006220	pyrimidine nucleotide metabolic process	IBA	biological process
GO:0004550	nucleoside diphosphate kinase activity	IBA	molecular function
GO:0006228	UTP biosynthetic process	IEA	biological process
GO:0006241	CTP biosynthetic process	IEA	biological process
GO:0004550	nucleoside diphosphate kinase activity	IEA	molecular function
GO:0006165	nucleoside diphosphate phosphorylation	IEA	biological process
GO:0006183	GTP biosynthetic process	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0009117	nucleotide metabolic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0004550	nucleoside diphosphate kinase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0015949	nucleobase-containing small molecule interconversion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00230	Purine metabolism
hsa00983	Drug metabolism - other enzymes
hsa00240	Pyrimidine metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881