• Gene id: 4829

Gene Summary

• Gene Symbol: NMBR   Gene   UCSC   Ensembl
• Aliases: BB1, BB1R, NMB-R
• Gene name: neuromedin B receptor
• Alternate names: neuromedin-B receptor, bombesin receptor 1, epididymis secretory sperm binding protein Li 185a, epididymis tissue protein Li 185a, neuromedin-B-preferring bombesin receptor,
• Gene location: 6q24.1 (61017719: 61051989)     Exons: 4     NC_000002.12
• Gene summary(Entrez): This gene encodes a 7-transmembrane G protein-coupled receptor that binds neuromedin B, which is a growth factor and mitogen for gastrointestinal epithelial tissue and for normal and neoplastic lung. This receptor may play a role in smooth muscle contract
• OMIM: 162341

Protein Summary

• Protein general information: P28336  
  • Name: Neuromedin B receptor (NMB R) (Epididymis tissue protein Li 185a) (Neuromedin B preferring bombesin receptor)
  • Length: 390  
  • Mass: 43435
  • Tissue specificity: Expressed in epididymis (at protein level). {ECO
• Sequence:

  MPSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYLLIITVGLLGNIMLVKIFITNSAMR
  SVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWMFGKVGCKLIPVIQLTSVGVSVFTLTALSADRYRAIVNPMD
  MQTSGALLRTCVKAMGIWVVSVLLAVPEAVFSEVARISSLDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPL
  AIISIYYYHIAKTLIKSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFIFCWFPNHILYMYRSFNYNEIDPSL
  GHMIVTLVARVLSFGNSCVNPFALYLLSESFRRHFNSQLCCGRKSYQERGTSYLLSSSAVRMTSLKSNAKNMVTN
  SVLLNGHSMKQEMAL

• Structural information:
  • Interpro: IPR001556  IPR000276  IPR017452  IPR001642  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000258042
• Other Databases: GeneCards:  NMBR  Malacards:  NMBR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004946	bombesin receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0008528	G protein-coupled peptide receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0031989	bombesin receptor signaling pathway	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004946	bombesin receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)