• Gene id: 4828

Gene Summary

• Gene Symbol: NMB   Gene   UCSC   Ensembl
• Gene name: neuromedin B
• Alternate names: neuromedin-B, Neuromedin-B-32, neuromedin-beta,
• Gene location: 15q25.2 (84658610: 84655131)     Exons: 4     NC_000015.10
• Gene summary(Entrez): This gene encodes a member of the bombesin-like family of neuropeptides, which negatively regulate eating behavior. The encoded protein may regulate colonic smooth muscle contraction through binding to its cognate receptor, the neuromedin B receptor (NMBR

Protein Summary

• Protein general information: P08949  
  • Name: Neuromedin B [Cleaved into: Neuromedin B 32; Neuromedin B]
  • Length: 121  
  • Mass: 13252
• Sequence:

  MARRAGGARMFGSLLLFALLAAGVAPLSWDLPEPRSRASKIRVHSRGNLWATGHFMGKKSLEPSSPSPLGTAPHT
  SLRDQRLQLSHDLLGILLLKKALGVSLSRPAPQIQYRRLLVQILQK

• Structural information:
  • Interpro: IPR000874  
  • Prosite: PS00257
  • PDB: 1C98 1C9A
  • PDBsum: 1C98 1C9A
  • STRING: ENSP00000378089
• Other Databases: GeneCards:  NMB  Malacards:  NMB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005184	neuropeptide hormone activity	IBA	molecular function
GO:0031710	neuromedin B receptor binding	IBA	molecular function
GO:0043005	neuron projection	IBA	cellular component
GO:0046887	positive regulation of hormone secretion	IBA	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0046887	positive regulation of hormone secretion	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0042593	glucose homeostasis	IEA	biological process
GO:0031710	neuromedin B receptor binding	IEA	molecular function
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0050482	arachidonic acid secretion	IEA	biological process
GO:0046888	negative regulation of hormone secretion	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
obesity	PMID:15585758
obesity	PMID:11194934
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881