• Gene id: 4824

Gene Summary

• Gene Symbol: NKX3-1   Gene   UCSC   Ensembl
• Aliases: BAPX2, NKX3, NKX3.1, NKX3A
• Gene name: NK3 homeobox 1
• Alternate names: homeobox protein Nkx-3.1, NK homeobox, family 3, A, NK3 transcription factor homolog A, NK3 transcription factor related, locus 1, homeobox protein NK-3 homolog A,
• Gene location: 8p21.2 (23682937: 23678692)     Exons: 4     NC_000008.11
• Gene summary(Entrez): This gene encodes a homeobox-containing transcription factor. This transcription factor functions as a negative regulator of epithelial cell growth in prostate tissue. Aberrant expression of this gene is associated with prostate tumor progression. Alterna
• OMIM: 602041

Protein Summary

• Protein general information: Q99801  
  • Name: Homeobox protein Nkx 3.1 (Homeobox protein NK 3 homolog A)
  • Length: 234  
  • Mass: 26350
  • Tissue specificity: Highly expressed in the prostate and, at a lower level, in the testis. {ECO
• Sequence:

  MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQ
  LSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLS
  APERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYC
  VGSWSPAFW

• Structural information:
  • Interpro: IPR009057  IPR017970  IPR001356  IPR020479  
  • Prosite: PS00027 PS50071
  • CDD: cd00086
  • PDB: 2L9R
  • PDBsum: 2L9R
  • DIP: 39687
  • STRING: ENSP00000370253
• Other Databases: GeneCards:  NKX3-1  Malacards:  NKX3-1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060664	epithelial cell proliferation involved in salivary gland morphogenesis	IEA	biological process
GO:0060442	branching involved in prostate gland morphogenesis	IEA	biological process
GO:0060037	pharyngeal system development	IEA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0035907	dorsal aorta development	IEA	biological process
GO:0033574	response to testosterone	IEA	biological process
GO:0008584	male gonad development	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0007507	heart development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0001756	somitogenesis	IEA	biological process
GO:0097162	MADS box domain binding	IEA	molecular function
GO:0060770	negative regulation of epithelial cell proliferation involved in prostate gland development	IEA	biological process
GO:0050680	negative regulation of epithelial cell proliferation	IEA	biological process
GO:0048754	branching morphogenesis of an epithelial tube	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0043569	negative regulation of insulin-like growth factor receptor signaling pathway	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0043491	protein kinase B signaling	IEA	biological process
GO:0030850	prostate gland development	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0007431	salivary gland development	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0001656	metanephros development	IEA	biological process
GO:0001655	urogenital system development	IEA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0005634	nucleus	IC	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045931	positive regulation of mitotic cell cycle	IMP	biological process
GO:0051781	positive regulation of cell division	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0090734	site of DNA damage	IDA	cellular component
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IDA	biological process
GO:2000836	positive regulation of androgen secretion	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0030521	androgen receptor signaling pathway	IDA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0071899	negative regulation of estrogen receptor binding	IDA	biological process
GO:0071850	mitotic cell cycle arrest	IDA	biological process
GO:0045930	negative regulation of mitotic cell cycle	IDA	biological process
GO:0010942	positive regulation of cell death	IDA	biological process
GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:2001235	positive regulation of apoptotic signaling pathway	IDA	biological process
GO:2001022	positive regulation of response to DNA damage stimulus	IDA	biological process
GO:0071383	cellular response to steroid hormone stimulus	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0043621	protein self-association	IDA	molecular function
GO:0030331	estrogen receptor binding	IDA	molecular function
GO:0071456	cellular response to hypoxia	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0004879	nuclear receptor activity	IDA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0030284	estrogen receptor activity	IDA	molecular function
GO:0010629	negative regulation of gene expression	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0032880	regulation of protein localization	IMP	biological process
GO:0071347	cellular response to interleukin-1	IEP	biological process
GO:0060664	epithelial cell proliferation involved in salivary gland morphogenesis	ISS	biological process
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0033574	response to testosterone	ISS	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005634	nucleus	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071356	cellular response to tumor necrosis factor	IEP	biological process
GO:0060770	negative regulation of epithelial cell proliferation involved in prostate gland development	ISS	biological process
GO:0050680	negative regulation of epithelial cell proliferation	ISS	biological process
GO:0048754	branching morphogenesis of an epithelial tube	ISS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0035690	cellular response to drug	IEP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0007431	salivary gland development	ISS	biological process
GO:0060442	branching involved in prostate gland morphogenesis	ISS	biological process
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0043569	negative regulation of insulin-like growth factor receptor signaling pathway	ISS	biological process
GO:0043491	protein kinase B signaling	IMP	biological process
GO:0003700	DNA-binding transcription factor activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05215	Prostate cancer

Diseases

Associated diseases	References
Prostate cancer	KEGG:H00024
Prostate cancer	KEGG:H00024
hepatocellular carcinoma	PMID:28972178
hepatocellular carcinoma	PMID:28972178
Male infertility	MIK: 18367176
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
18367176	Male infertility				Male infertility	Microarray