• Gene id: 482

Gene Summary

• Gene Symbol: ATP1B2   Gene   UCSC   Ensembl
• Aliases: AMOG
• Gene name: ATPase Na+/K+ transporting subunit beta 2
• Alternate names: sodium/potassium-transporting ATPase subunit beta-2, ATPase, Na+/K+ transporting, beta 2 polypeptide, Na, K-ATPase beta-2 polypeptide, adhesion molecule in glia, adhesion molecule on glia, sodium pump subunit beta-2, sodium-potassium ATPase subunit beta 2 (non-,
• Gene location: 17p13.1 (7646626: 7657770)     Exons: 8     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemica
• OMIM: 603244

Protein Summary

• Protein general information: P14415  
  • Name: Sodium/potassium transporting ATPase subunit beta 2 (Adhesion molecule in glia) (AMOG) (Sodium/potassium dependent ATPase subunit beta 2)
  • Length: 290  
  • Mass: 33367
• Sequence:

  MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQTVSDHTPKYQD
  RLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRAC
  QFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDL
  MYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT

• Structural information:
  • Interpro: IPR000402  IPR038702  
  • Prosite: PS00390 PS00391
  • STRING: ENSP00000250111
• Other Databases: GeneCards:  ATP1B2  Malacards:  ATP1B2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0016328	lateral plasma membrane	IDA	cellular component
GO:0097449	astrocyte projection	IDA	cellular component
GO:0046982	protein heterodimerization activity	ISS	molecular function
GO:0046982	protein heterodimerization activity	ISS	molecular function
GO:0120036	plasma membrane bounded cell projection organization	ISS	biological process
GO:0045494	photoreceptor cell maintenance	ISS	biological process
GO:0061744	motor behavior	ISS	biological process
GO:0071944	cell periphery	ISS	cellular component
GO:0044298	cell body membrane	ISS	cellular component
GO:0031253	cell projection membrane	ISS	cellular component
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:1903976	negative regulation of glial cell migration	ISS	biological process
GO:0001895	retina homeostasis	ISS	biological process
GO:0001917	photoreceptor inner segment	ISS	cellular component
GO:0005890	sodium:potassium-exchanging ATPase complex	ISS	cellular component
GO:0005890	sodium:potassium-exchanging ATPase complex	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0009897	external side of plasma membrane	ISS	cellular component
GO:0016020	membrane	ISS	cellular component
GO:0098984	neuron to neuron synapse	ISS	cellular component
GO:0097449	astrocyte projection	ISS	cellular component
GO:0097449	astrocyte projection	ISS	cellular component
GO:0097450	astrocyte end-foot	ISS	cellular component
GO:0031589	cell-substrate adhesion	ISS	biological process
GO:0021678	third ventricle development	ISS	biological process
GO:0021944	neuronal-glial interaction involved in hindbrain glial-mediated radial cell migration	ISS	biological process
GO:0010976	positive regulation of neuron projection development	ISS	biological process
GO:0021670	lateral ventricle development	ISS	biological process
GO:0006883	cellular sodium ion homeostasis	IBA	biological process
GO:0036376	sodium ion export across plasma membrane	IBA	biological process
GO:0001671	ATPase activator activity	IBA	molecular function
GO:0005391	sodium:potassium-exchanging ATPase activity	IBA	contributes to
GO:0005890	sodium:potassium-exchanging ATPase complex	IBA	cellular component
GO:0030007	cellular potassium ion homeostasis	IBA	biological process
GO:1990573	potassium ion import across plasma membrane	IBA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0005890	sodium:potassium-exchanging ATPase complex	IEA	cellular component
GO:0006813	potassium ion transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006813	potassium ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0034220	ion transmembrane transport	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:1903779	regulation of cardiac conduction	TAS	biological process
GO:0120036	plasma membrane bounded cell projection organization	IEA	biological process
GO:0045494	photoreceptor cell maintenance	IEA	biological process
GO:0044298	cell body membrane	IEA	cellular component
GO:0031589	cell-substrate adhesion	IEA	biological process
GO:0031253	cell projection membrane	IEA	cellular component
GO:0021944	neuronal-glial interaction involved in hindbrain glial-mediated radial cell migration	IEA	biological process
GO:0021678	third ventricle development	IEA	biological process
GO:0001895	retina homeostasis	IEA	biological process
GO:1903976	negative regulation of glial cell migration	IEA	biological process
GO:0098984	neuron to neuron synapse	IEA	cellular component
GO:0097450	astrocyte end-foot	IEA	cellular component
GO:0097449	astrocyte projection	IEA	cellular component
GO:0061744	motor behavior	IEA	biological process
GO:0021670	lateral ventricle development	IEA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0001917	photoreceptor inner segment	IEA	cellular component
GO:0005391	sodium:potassium-exchanging ATPase activity	IDA	contributes to
GO:0001671	ATPase activator activity	IDA	molecular function
GO:0005391	sodium:potassium-exchanging ATPase activity	IDA	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0030007	cellular potassium ion homeostasis	IDA	biological process
GO:1990573	potassium ion import across plasma membrane	IDA	biological process
GO:0030007	cellular potassium ion homeostasis	IDA	biological process
GO:0005890	sodium:potassium-exchanging ATPase complex	IDA	cellular component
GO:1903278	positive regulation of sodium ion export across plasma membrane	IDA	biological process
GO:1903288	positive regulation of potassium ion import across plasma membrane	IDA	biological process
GO:0006883	cellular sodium ion homeostasis	IDA	biological process
GO:0050821	protein stabilization	IDA	biological process
GO:0006883	cellular sodium ion homeostasis	IDA	biological process
GO:0036376	sodium ion export across plasma membrane	IDA	biological process
GO:1901018	positive regulation of potassium ion transmembrane transporter activity	IDA	biological process
GO:0036376	sodium ion export across plasma membrane	IDA	biological process
GO:0032781	positive regulation of ATPase activity	IDA	biological process
GO:0086009	membrane repolarization	IDA	biological process
GO:1990573	potassium ion import across plasma membrane	IDA	biological process
GO:0005890	sodium:potassium-exchanging ATPase complex	IDA	cellular component
GO:0086064	cell communication by electrical coupling involved in cardiac conduction	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0010248	establishment or maintenance of transmembrane electrochemical gradient	IEA	biological process
GO:0010248	establishment or maintenance of transmembrane electrochemical gradient	IEA	biological process
GO:0010248	establishment or maintenance of transmembrane electrochemical gradient	IEA	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04024	cAMP signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04919	Thyroid hormone signaling pathway
hsa04974	Protein digestion and absorption
hsa04260	Cardiac muscle contraction
hsa04925	Aldosterone synthesis and secretion
hsa04972	Pancreatic secretion
hsa04970	Salivary secretion
hsa04911	Insulin secretion
hsa04971	Gastric acid secretion
hsa04918	Thyroid hormone synthesis
hsa04978	Mineral absorption
hsa04976	Bile secretion
hsa04961	Endocrine and other factor-regulated calcium reabsorption
hsa04973	Carbohydrate digestion and absorption
hsa04960	Aldosterone-regulated sodium reabsorption
hsa04964	Proximal tubule bicarbonate reclamation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R