About Us

Search Result


Gene id 481
Gene Summary     SNPs    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol ATP1B1   Gene   UCSC   Ensembl
Aliases ATP1B
Gene name ATPase Na+/K+ transporting subunit beta 1
Alternate names sodium/potassium-transporting ATPase subunit beta-1, ATPase, Na+/K+ transporting, beta 1 polypeptide, Beta 1-subunit of Na(+),K(+)-ATPase, Na, K-ATPase beta-1 polypeptide, adenosinetriphosphatase, sodium pump subunit beta-1, sodium-potassium ATPase subunit beta,
Gene location 1q24.2 (169106689: 169132718)     Exons: 6     NC_000001.11
Gene summary(Entrez) The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemica
OMIM 605016

SNPs


rs2369679

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000014.9   g.96456415C>G
NC_000014.9   g.96456415C>T
NC_000014.8   g.96922752C>G
NC_000014.8   g.96922752C>T
NG_054631.1   g.69305C>G
NG_054631.1   g.69305C>T
NM_152327.5   c.1167C>G
NM_152327.5   c.1167C>T
NM_152327.4   c.1167C>G
NM_152327.4   c.1167C>T
NM_152327.3  

Protein Summary

Protein general information P05026  

Name: Sodium/potassium transporting ATPase subunit beta 1 (Sodium/potassium dependent ATPase subunit beta 1)

Length: 303  Mass: 35061

Tissue specificity: Found in most tissues.

Sequence MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPP
GLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCR
FKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVG
NVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIE
VKS
Structural information
Interpro:  IPR000402  IPR015565  IPR038702  
Prosite:   PS00390 PS00391
MINT:  
STRING:   ENSP00000356790
Other Databases GeneCards:  ATP1B1  Malacards:  ATP1B1

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0016324 apical plasma membrane
IDA cellular component
GO:0036126 sperm flagellum
IDA cellular component
GO:0016328 lateral plasma membrane
IDA cellular component
GO:0005391 sodium:potassium-exchangi
ng ATPase activity
IGI contributes to
GO:0005391 sodium:potassium-exchangi
ng ATPase activity
IGI contributes to
GO:0005391 sodium:potassium-exchangi
ng ATPase activity
IGI contributes to
GO:0051117 ATPase binding
IPI molecular function
GO:0019829 ATPase-coupled cation tra
nsmembrane transporter ac
tivity
IGI contributes to
GO:0019829 ATPase-coupled cation tra
nsmembrane transporter ac
tivity
IGI contributes to
GO:0019829 ATPase-coupled cation tra
nsmembrane transporter ac
tivity
IGI contributes to
GO:0046982 protein heterodimerizatio
n activity
ISS molecular function
GO:0046982 protein heterodimerizatio
n activity
ISS molecular function
GO:0098655 cation transmembrane tran
sport
IGI biological process
GO:0035725 sodium ion transmembrane
transport
IGI biological process
GO:0035725 sodium ion transmembrane
transport
IGI biological process
GO:0030315 T-tubule
IGI cellular component
GO:0005890 sodium:potassium-exchangi
ng ATPase complex
ISS cellular component
GO:0005890 sodium:potassium-exchangi
ng ATPase complex
IPI cellular component
GO:0005890 sodium:potassium-exchangi
ng ATPase complex
ISS cellular component
GO:0005886 plasma membrane
IGI cellular component
GO:0031090 organelle membrane
IGI cellular component
GO:0071805 potassium ion transmembra
ne transport
IGI biological process
GO:0071805 potassium ion transmembra
ne transport
IGI biological process
GO:0006883 cellular sodium ion homeo
stasis
IBA biological process
GO:0036376 sodium ion export across
plasma membrane
IBA biological process
GO:0001671 ATPase activator activity
IBA molecular function
GO:0005391 sodium:potassium-exchangi
ng ATPase activity
IBA contributes to
GO:0005890 sodium:potassium-exchangi
ng ATPase complex
IBA cellular component
GO:0030007 cellular potassium ion ho
meostasis
IBA biological process
GO:1990573 potassium ion import acro
ss plasma membrane
IBA biological process
GO:0005515 protein binding
IPI molecular function
GO:0006814 sodium ion transport
IEA biological process
GO:0005890 sodium:potassium-exchangi
ng ATPase complex
IEA cellular component
GO:0006813 potassium ion transport
IEA biological process
GO:0006814 sodium ion transport
IEA biological process
GO:0006814 sodium ion transport
IEA biological process
GO:0007155 cell adhesion
IEA biological process
GO:0005886 plasma membrane
IEA cellular component
GO:0006811 ion transport
IEA biological process
GO:0006813 potassium ion transport
IEA biological process
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0006813 potassium ion transport
IEA biological process
GO:0016020 membrane
IEA cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0034220 ion transmembrane transpo
rt
TAS biological process
GO:0050900 leukocyte migration
TAS biological process
GO:1903779 regulation of cardiac con
duction
TAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0030001 metal ion transport
IEA biological process
GO:0016323 basolateral plasma membra
ne
IEA cellular component
GO:0006814 sodium ion transport
IEA biological process
GO:0005901 caveola
IEA cellular component
GO:0001666 response to hypoxia
IEA biological process
GO:1903281 positive regulation of ca
lcium:sodium antiporter a
ctivity
IEA biological process
GO:1903169 regulation of calcium ion
transmembrane transport
IEA biological process
GO:0050821 protein stabilization
IEA biological process
GO:0016323 basolateral plasma membra
ne
IEA cellular component
GO:0014704 intercalated disc
IEA cellular component
GO:0010882 regulation of cardiac mus
cle contraction by calciu
m ion signaling
IEA biological process
GO:0008022 protein C-terminus bindin
g
IEA molecular function
GO:0006874 cellular calcium ion home
ostasis
IEA biological process
GO:0046982 protein heterodimerizatio
n activity
IEA molecular function
GO:0016324 apical plasma membrane
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0006813 potassium ion transport
IEA biological process
GO:0005890 sodium:potassium-exchangi
ng ATPase complex
IEA cellular component
GO:0005391 sodium:potassium-exchangi
ng ATPase activity
IEA molecular function
GO:0060048 cardiac muscle contractio
n
IEA biological process
GO:0055119 relaxation of cardiac mus
cle
IEA biological process
GO:0042383 sarcolemma
IEA cellular component
GO:0019901 protein kinase binding
IEA molecular function
GO:0016324 apical plasma membrane
IEA cellular component
GO:0010468 regulation of gene expres
sion
IEA biological process
GO:0005890 sodium:potassium-exchangi
ng ATPase complex
IEA cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0005391 sodium:potassium-exchangi
ng ATPase activity
IEA molecular function
GO:0005391 sodium:potassium-exchangi
ng ATPase activity
ISS contributes to
GO:0005890 sodium:potassium-exchangi
ng ATPase complex
ISS cellular component
GO:0005391 sodium:potassium-exchangi
ng ATPase activity
IDA contributes to
GO:0001671 ATPase activator activity
IDA molecular function
GO:0031402 sodium ion binding
IDA contributes to
GO:0030955 potassium ion binding
IDA contributes to
GO:0016887 ATPase activity
IDA contributes to
GO:0005524 ATP binding
IDA contributes to
GO:0005391 sodium:potassium-exchangi
ng ATPase activity
IDA contributes to
GO:0005391 sodium:potassium-exchangi
ng ATPase activity
IDA contributes to
GO:0051117 ATPase binding
IPI molecular function
GO:0051117 ATPase binding
IPI molecular function
GO:0051117 ATPase binding
IPI molecular function
GO:0008144 drug binding
IPI contributes to
GO:0051117 ATPase binding
IPI molecular function
GO:0006883 cellular sodium ion homeo
stasis
IDA biological process
GO:0050821 protein stabilization
IDA biological process
GO:0006883 cellular sodium ion homeo
stasis
IDA biological process
GO:0036376 sodium ion export across
plasma membrane
IDA biological process
GO:1901018 positive regulation of po
tassium ion transmembrane
transporter activity
IDA biological process
GO:0086013 membrane repolarization d
uring cardiac muscle cell
action potential
IC biological process
GO:0030007 cellular potassium ion ho
meostasis
IDA biological process
GO:1990573 potassium ion import acro
ss plasma membrane
IDA biological process
GO:0030007 cellular potassium ion ho
meostasis
IDA biological process
GO:0005890 sodium:potassium-exchangi
ng ATPase complex
IDA cellular component
GO:0032781 positive regulation of AT
Pase activity
IDA biological process
GO:1903278 positive regulation of so
dium ion export across pl
asma membrane
IDA biological process
GO:1903288 positive regulation of po
tassium ion import across
plasma membrane
IDA biological process
GO:0072659 protein localization to p
lasma membrane
IDA biological process
GO:0036376 sodium ion export across
plasma membrane
IDA biological process
GO:0046034 ATP metabolic process
IDA biological process
GO:0016020 membrane
IDA cellular component
GO:0005890 sodium:potassium-exchangi
ng ATPase complex
IDA cellular component
GO:0086009 membrane repolarization
IDA biological process
GO:0005886 plasma membrane
IDA cellular component
GO:1990573 potassium ion import acro
ss plasma membrane
IDA biological process
GO:0005890 sodium:potassium-exchangi
ng ATPase complex
IDA cellular component
GO:0044861 protein transport into pl
asma membrane raft
TAS biological process
GO:0006874 cellular calcium ion home
ostasis
ISS biological process
GO:0010882 regulation of cardiac mus
cle contraction by calciu
m ion signaling
ISS biological process
GO:0014704 intercalated disc
ISS cellular component
GO:0050821 protein stabilization
ISS biological process
GO:1903281 positive regulation of ca
lcium:sodium antiporter a
ctivity
ISS biological process
GO:0036376 sodium ion export across
plasma membrane
ISS biological process
GO:0086064 cell communication by ele
ctrical coupling involved
in cardiac conduction
TAS biological process
GO:0055119 relaxation of cardiac mus
cle
ISS biological process
GO:0060048 cardiac muscle contractio
n
ISS biological process
GO:0042383 sarcolemma
ISS cellular component
GO:0010468 regulation of gene expres
sion
ISS biological process
GO:0005515 protein binding
IPI molecular function
GO:1990573 potassium ion import acro
ss plasma membrane
ISS biological process
GO:0005886 plasma membrane
IEA cellular component
GO:0042383 sarcolemma
IEA cellular component
GO:0010248 establishment or maintena
nce of transmembrane elec
trochemical gradient
IEA biological process
GO:0010248 establishment or maintena
nce of transmembrane elec
trochemical gradient
IEA biological process
GO:0010248 establishment or maintena
nce of transmembrane elec
trochemical gradient
IEA biological process
GO:0010248 establishment or maintena
nce of transmembrane elec
trochemical gradient
IEA biological process
GO:0010248 establishment or maintena
nce of transmembrane elec
trochemical gradient
IEA biological process
GO:0010248 establishment or maintena
nce of transmembrane elec
trochemical gradient
IEA biological process
GO:0010248 establishment or maintena
nce of transmembrane elec
trochemical gradient
IEA biological process
GO:0010248 establishment or maintena
nce of transmembrane elec
trochemical gradient
IEA biological process
GO:0010248 establishment or maintena
nce of transmembrane elec
trochemical gradient
IEA biological process
GO:0010248 establishment or maintena
nce of transmembrane elec
trochemical gradient
IEA biological process
GO:0070062 extracellular exosome
HDA cellular component
GO:0070062 extracellular exosome
HDA cellular component
GO:0023026 MHC class II protein comp
lex binding
HDA molecular function
GO:1903561 extracellular vesicle
HDA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04024cAMP signaling pathway
hsa04022cGMP-PKG signaling pathway
hsa04261Adrenergic signaling in cardiomyocytes
hsa04919Thyroid hormone signaling pathway
hsa04974Protein digestion and absorption
hsa04260Cardiac muscle contraction
hsa04925Aldosterone synthesis and secretion
hsa04972Pancreatic secretion
hsa04970Salivary secretion
hsa04911Insulin secretion
hsa04971Gastric acid secretion
hsa04918Thyroid hormone synthesis
hsa04978Mineral absorption
hsa04976Bile secretion
hsa04961Endocrine and other factor-regulated calcium reabsorption
hsa04973Carbohydrate digestion and absorption
hsa04960Aldosterone-regulated sodium reabsorption
hsa04964Proximal tubule bicarbonate reclamation
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Spermatogenic defects MIK: 31037746

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
31037746 Spermatoge
nic defect
s

16 (1 control,
15 cases)
Male infertility GSE6023 analyzed using GEO2R
Show abstract