• Gene id: 4809

Gene Summary

• Gene Symbol: SNU13   Gene   UCSC   Ensembl
• Aliases: 15.5K, FA-1, FA1, NHP2L1, NHPX, OTK27, SNRNP15-5, SPAG12, SSFA1
• Gene name: small nuclear ribonucleoprotein 13
• Alternate names: NHP2-like protein 1, NHP2 non-histone chromosome protein 2-like 1, SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5), U4/U6.U5 tri-snRNP 15.5 kDa protein, [U4/U6.U5] tri-snRNP 15.5 kD RNA binding protein, high mobility group-like nuclear protein 2 homo,
• Gene location: 22q13.2 (118726953: 118794532)     Exons: 12     NC_000023.11
• Gene summary(Entrez): Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop o
• OMIM: 601304

Protein Summary

• Protein general information: P55769  
  • Name: NHP2 like protein 1 (High mobility group like nuclear protein 2 homolog 1) (OTK27) (SNU13 homolog) (hSNU13) (U4/U6.U5 small nuclear ribonucleoprotein SNU13) (U4/U6.U5 tri snRNP 15.5 kDa protein) [Cleaved into: NHP2 like protein 1, N terminally processed]
  • Length: 128  
  • Mass: 14174
  • Tissue specificity: Ubiquitous.
• Sequence:

  MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCED
  KNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV

• Structural information:
  • Interpro: IPR002415  IPR029064  IPR004038  IPR018492  IPR004037  
  • Prosite: PS01082
  • PDB: 1E7K 2JNB 2OZB 3JCR 3SIU 3SIV 5O9Z 6AH0 6AHD 6QW6 6QX9
  • PDBsum: 1E7K 2JNB 2OZB 3JCR 3SIU 3SIV 5O9Z 6AH0 6AHD 6QW6 6QX9
  • STRING: ENSP00000383949
• Other Databases: GeneCards:  SNU13  Malacards:  SNU13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000398	mRNA splicing, via spliceosome	IBA	biological process
GO:0000470	maturation of LSU-rRNA	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0030490	maturation of SSU-rRNA	IBA	biological process
GO:0031428	box C/D snoRNP complex	IBA	cellular component
GO:0032040	small-subunit processome	IBA	cellular component
GO:0046540	U4/U6 x U5 tri-snRNP complex	IBA	cellular component
GO:0071011	precatalytic spliceosome	IBA	cellular component
GO:0005690	U4atac snRNP	IDA	cellular component
GO:0030622	U4atac snRNA binding	IDA	molecular function
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0046540	U4/U6 x U5 tri-snRNP complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0071005	U2-type precatalytic spliceosome	IDA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0042254	ribosome biogenesis	IEA	biological process
GO:1990904	ribonucleoprotein complex	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0006364	rRNA processing	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034512	box C/D snoRNA binding	IEA	molecular function
GO:0007338	single fertilization	IEA	biological process
GO:0031428	box C/D snoRNP complex	IEA	cellular component
GO:0000492	box C/D snoRNP assembly	IEA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0030515	snoRNA binding	IDA	contributes to
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031428	box C/D snoRNP complex	NAS	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001651	dense fibrillar component	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0034512	box C/D snoRNA binding	IDA	molecular function
GO:0030621	U4 snRNA binding	IDA	molecular function
GO:0030621	U4 snRNA binding	IDA	molecular function
GO:0030622	U4atac snRNA binding	IDA	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0031428	box C/D snoRNP complex	IDA	cellular component
GO:0034511	U3 snoRNA binding	IDA	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray