• Gene id: 4804

Gene Summary

• Gene Symbol: NGFR   Gene   UCSC   Ensembl
• Aliases: CD271, Gp80-LNGFR, TNFRSF16, p75(NTR), p75NTR
• Gene name: nerve growth factor receptor
• Alternate names: tumor necrosis factor receptor superfamily member 16, NGF receptor, TNFR superfamily, member 16, low affinity neurotrophin receptor p75NTR, low-affinity nerve growth factor receptor, p75 ICD,
• Gene location: 17q21.33 (49495292: 49515007)     Exons: 6     NC_000017.11
• Gene summary(Entrez): Nerve growth factor receptor contains an extracellular domain containing four 40-amino acid repeats with 6 cysteine residues at conserved positions followed by a serine/threonine-rich region, a single transmembrane domain, and a 155-amino acid cytoplasmic
• OMIM: 612839

Protein Summary

• Protein general information: P08138  
  • Name: Tumor necrosis factor receptor superfamily member 16 (Gp80 LNGFR) (Low affinity neurotrophin receptor p75NTR) (Low affinity nerve growth factor receptor) (NGF receptor) (p75 ICD) (CD antigen CD271)
  • Length: 427  
  • Mass: 45183
• Sequence:

  MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDSVTFSD
  VVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQDKQNTVCEECP
  DGTYSDEANHVDPCLPCTVCEDTERQLRECTRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIA
  STVAGVVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
  LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWRHLAGELGYQPEHIDS
  FTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSESTATSPV

• Structural information:
  • Protein Domains: (344..42-)
    (/note="Death-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00064"-)
  • Interpro: IPR011029  IPR000488  IPR001368  IPR041448  IPR022325   IPR034046  
  • Prosite: PS50017 PS00652 PS50050
  • CDD: cd13416
  • PDB: 2N80 2N83 2N97 3EWV 5ZGG
  • PDBsum: 2N80 2N83 2N97 3EWV 5ZGG
  • DIP: 406
  • STRING: ENSP00000172229
• Other Databases: GeneCards:  NGFR  Malacards:  NGFR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904646	cellular response to amyloid-beta	IDA	biological process
GO:0001540	amyloid-beta binding	TAS	molecular function
GO:0005035	death receptor activity	IGI	molecular function
GO:0016021	integral component of membrane	NAS	cellular component
GO:0051402	neuron apoptotic process	IGI	biological process
GO:0005035	death receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0009986	cell surface	IBA	cellular component
GO:0015026	coreceptor activity	IBA	molecular function
GO:0007266	Rho protein signal transduction	IBA	biological process
GO:0048406	nerve growth factor binding	IBA	molecular function
GO:0007266	Rho protein signal transduction	IDA	biological process
GO:0005516	calmodulin binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0015026	coreceptor activity	IDA	molecular function
GO:0048406	nerve growth factor binding	ISS	molecular function
GO:0043121	neurotrophin binding	ISS	molecular function
GO:0042593	glucose homeostasis	ISS	biological process
GO:0017137	Rab GTPase binding	ISS	molecular function
GO:0001678	cellular glucose homeostasis	ISS	biological process
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0006886	intracellular protein transport	ISS	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0031293	membrane protein intracellular domain proteolysis	TAS	biological process
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0043281	regulation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0048011	neurotrophin TRK receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0050771	negative regulation of axonogenesis	TAS	biological process
GO:0050772	positive regulation of axonogenesis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051799	negative regulation of hair follicle development	IEA	biological process
GO:0048406	nerve growth factor binding	IEA	molecular function
GO:0042593	glucose homeostasis	IEA	biological process
GO:0031069	hair follicle morphogenesis	IEA	biological process
GO:0017137	Rab GTPase binding	IEA	molecular function
GO:0007417	central nervous system development	IEA	biological process
GO:0005911	cell-cell junction	IEA	cellular component
GO:2001235	positive regulation of apoptotic signaling pathway	IEA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IEA	biological process
GO:0043588	skin development	IEA	biological process
GO:0042488	positive regulation of odontogenesis of dentin-containing tooth	IEA	biological process
GO:0040037	negative regulation of fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0035907	dorsal aorta development	IEA	biological process
GO:0032922	circadian regulation of gene expression	IEA	biological process
GO:0021675	nerve development	IEA	biological process
GO:0016048	detection of temperature stimulus	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0010468	regulation of gene expression	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0007623	circadian rhythm	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005035	death receptor activity	IEA	molecular function
GO:0001678	cellular glucose homeostasis	IEA	biological process
GO:0009986	cell surface	ISS	cellular component
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	IDA	biological process
GO:1900182	positive regulation of protein localization to nucleus	IDA	biological process
GO:1903588	negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IGI	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0043204	perikaryon	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa05202	Transcriptional misregulation in cancer
hsa04722	Neurotrophin signaling pathway
hsa04215	Apoptosis - multiple species

Diseases

Associated diseases	References
Hirschsprung's disease	PMID:7807351
Alzheimer's disease	PMID:2557638
Alzheimer's disease	PMID:18780967
Lewy body dementia	PMID:8347330
Huntington's disease	PMID:18093249
Parkinson's disease	PMID:8347330
Urticaria	PMID:12653731
Mental depression	PMID:15274039
pancreatic cancer	PMID:16704535
Atherosclerosis	PMID:11689207
Multiple sclerosis	PMID:11829348
Atopic dermatitis	PMID:16586073
Coronary artery disease	PMID:11935372
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray