• Gene id: 4803

Gene Summary

• Gene Symbol: NGF   Gene   UCSC   Ensembl
• Aliases: Beta-NGF, HSAN5, NGFB
• Gene name: nerve growth factor
• Alternate names: beta-nerve growth factor, nerve growth factor (beta polypeptide), nerve growth factor, beta subunit,
• Gene location: 1p13.2 (115338252: 115285914)     Exons: 4     NC_000001.11
• Gene summary(Entrez): This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the d
• OMIM: 162030

Protein Summary

• Protein general information: P01138  
  • Name: Beta nerve growth factor (Beta NGF)
  • Length: 241  
  • Mass: 26,959
• Sequence:

  MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPR
  LFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTAT
  DIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRI
  DTACVCVLSRKAVRRA

• Structural information:
  • Interpro: IPR029034  IPR020408  IPR002072  IPR020425  IPR020437   IPR019846  
  • Prosite: PS00248 PS50270
  • PDB: 1SG1 1WWW 2IFG 4EDW 4EDX 4ZBN 5JZ7
  • PDBsum: 1SG1 1WWW 2IFG 4EDW 4EDX 4ZBN 5JZ7
  • DIP: 5712
  • STRING: ENSP00000358525
• Other Databases: GeneCards:  NGF  Malacards:  NGF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000186	activation of MAPKK activity	TAS	biological process
GO:0005163	nerve growth factor receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IBA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0007018	microtubule-based movement	TAS	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0007267	cell-cell signaling	IBA	biological process
GO:0008083	growth factor activity	IBA	molecular function
GO:0008191	metalloendopeptidase inhibitor activity	IDA	molecular function
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IDA	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0032455	nerve growth factor processing	TAS	biological process
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0043281	regulation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0043524	negative regulation of neuron apoptotic process	IBA	biological process
GO:0045664	regulation of neuron differentiation	IBA	biological process
GO:0048011	neurotrophin TRK receptor signaling pathway	TAS	biological process
GO:0048011	neurotrophin TRK receptor signaling pathway	TAS	biological process
GO:0048015	phosphatidylinositol-mediated signaling	TAS	biological process
GO:0048812	neuron projection morphogenesis	IDA	biological process
GO:0050772	positive regulation of axonogenesis	TAS	biological process
GO:0000186	activation of MAPKK activity	TAS	biological process
GO:0004857	enzyme inhibitor activity	IEA	molecular function
GO:0005102	receptor binding	IEA	molecular function
GO:0005163	nerve growth factor receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0007018	microtubule-based movement	TAS	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0007267	cell-cell signaling	IBA	biological process
GO:0008083	growth factor activity	IBA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0008191	metalloendopeptidase inhibitor activity	IEA	molecular function
GO:0008191	metalloendopeptidase inhibitor activity	IDA	molecular function
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IDA	biological process
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0032455	nerve growth factor processing	TAS	biological process
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0043281	regulation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0043524	negative regulation of neuron apoptotic process	IBA	biological process
GO:0045664	regulation of neuron differentiation	IBA	biological process
GO:0048011	neurotrophin TRK receptor signaling pathway	TAS	biological process
GO:0048011	neurotrophin TRK receptor signaling pathway	TAS	biological process
GO:0048015	phosphatidylinositol-mediated signaling	TAS	biological process
GO:0048812	neuron projection morphogenesis	IDA	biological process
GO:0050772	positive regulation of axonogenesis	TAS	biological process
GO:0000186	activation of MAPKK activity	TAS	biological process
GO:0005163	nerve growth factor receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IBA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0007018	microtubule-based movement	TAS	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0007267	cell-cell signaling	IBA	biological process
GO:0008083	growth factor activity	IBA	molecular function
GO:0008191	metalloendopeptidase inhibitor activity	IDA	molecular function
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IDA	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0032455	nerve growth factor processing	TAS	biological process
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0043281	regulation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0043524	negative regulation of neuron apoptotic process	IBA	biological process
GO:0045664	regulation of neuron differentiation	IBA	biological process
GO:0048011	neurotrophin TRK receptor signaling pathway	TAS	biological process
GO:0048011	neurotrophin TRK receptor signaling pathway	TAS	biological process
GO:0048015	phosphatidylinositol-mediated signaling	TAS	biological process
GO:0048812	neuron projection morphogenesis	IDA	biological process
GO:0050772	positive regulation of axonogenesis	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04210	Apoptosis
hsa04722	Neurotrophin signaling pathway
hsa04750	Inflammatory mediator regulation of TRP channels

Diseases

Associated diseases	References
Cardiovascular disease	GAD: 16313302
Neuropathy	OMIM: 162030
Multiple sclerosis	GAD: 18563468
Alzheimer's disease	GAD: 18780967
Attention deficit hyperactivity disorder (ADHD)	GAD: 18179783
Autism	GAD: 19598235
Psychological disorders	GAD: 20398908
Chronic renal failure	GAD: 21085059
Diminished ovarian reserve (DOR)	INFBASE: 18222435
Female infertility	INFBASE: 26604067
Endometriosis	INFBASE: 20001709
Ovarian endometriosis	INFBASE: 12093857
Peritoneal endometriosis	INFBASE: 12093857
Asthenozoospermia	MIK: 20542022
Male factor infertility	MIK: 23971410
Oligoasthenozoospermia	MIK: 20542022
Sperm motility	MIK: 25418418
Adenomyosis	INFBASE: 12093857
Dermatitis	GAD: 19038326
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Oligoasthenozoospermia	MIK: 20542022
Asthenozoospermia	MIK: 20542022
Spermatogenic defects	MIK: 31037746
Male infertiltiy	MIK: 25418418

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25418418	Sperm motility, Male infertiltiy				Male infertility
20542022	Oligoasthenozoospermic, asthenozoospermic				Male infertility	NGF
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R