• Gene id: 4793

Gene Summary

• Gene Symbol: NFKBIB   Gene   UCSC   Ensembl
• Aliases: IKBB, TRIP9
• Gene name: NFKB inhibitor beta
• Alternate names: NF-kappa-B inhibitor beta, I-kappa-B-beta, NF-kappa-BIB, TR-interacting protein 9, TRIP-9, ikB-B, ikB-beta, ikappaBbeta, nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta, thyroid receptor-interacting protein 9,
• Gene location: 19q13.2 (38899502: 38908893)     Exons: 7     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the NF-kappa-B inhibitor family, which inhibit NF-kappa-B by complexing with, and trapping it in the cytoplasm. Phosphorylation of serine residues on these proteins by kinases marks them for destruction via the
• OMIM: 604495

Protein Summary

• Protein general information: Q15653  
  • Name: NF kappa B inhibitor beta (NF kappa BIB) (I kappa B beta) (IkB B) (IkB beta) (IkappaBbeta) (Thyroid receptor interacting protein 9) (TR interacting protein 9) (TRIP 9)
  • Length: 356  
  • Mass: 37771
  • Tissue specificity: Expressed in all tissues examined.
• Sequence:

  MAGVACLGKAADADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDTALHLAVIHQHEPFLD
  FLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARALLQPR
  PRRPREAPDTYLAQGPDRTPDTNHTPVALYPDSDLEKEEEESEEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRL
  LRDAGADLDKPEPTCGRSPLHLAVEAQAADVLELLLRAGANPAARMYGGRTPLGSAMLRPNPILARLLRAHGAPE
  PEGEDEKSGPCSSSSDSDSGDEGDEYDDIVVHSSRSQTRLPPTPASKPLPDDPRPV

• Structural information:
  • Interpro: IPR002110  IPR020683  IPR036770  
  • Prosite: PS50297 PS50088
  • DIP: 27532
  • STRING: ENSP00000312988
• Other Databases: GeneCards:  NFKBIB  Malacards:  NFKBIB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071222	cellular response to lipopolysaccharide	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0007253	cytoplasmic sequestering of NF-kappaB	IBA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0006351	transcription, DNA-templated	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa04062	Chemokine signaling pathway
hsa05130	Pathogenic Escherichia coli infection
hsa05169	Epstein-Barr virus infection
hsa04621	NOD-like receptor signaling pathway
hsa05164	Influenza A
hsa04722	Neurotrophin signaling pathway
hsa05162	Measles
hsa04660	T cell receptor signaling pathway
hsa04659	Th17 cell differentiation
hsa05145	Toxoplasmosis
hsa04662	B cell receptor signaling pathway
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa04658	Th1 and Th2 cell differentiation
hsa04622	RIG-I-like receptor signaling pathway
hsa04920	Adipocytokine signaling pathway
hsa05140	Leishmaniasis
hsa04623	Cytosolic DNA-sensing pathway

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R