• Gene id: 4781

Gene Summary

• Gene Symbol: NFIB   Gene   UCSC   Ensembl
• Aliases: CTF, HMGIC/NFIB, MACID, NF-I/B, NF1-B, NFI-B, NFI-RED, NFIB2, NFIB3
• Gene name: nuclear factor I B
• Alternate names: nuclear factor 1 B-type, CCAAT-box-binding transcription factor, TGGCA-binding protein, nuclear factor 1/B,
• Gene location: 9p23-p22.3 (14532076: 14081842)     Exons: 22     NC_000009.12
• OMIM: 600728

Protein Summary

• Protein general information: O00712  
  • Name: Nuclear factor 1 B type (NF1 B) (Nuclear factor 1/B) (CCAAT box binding transcription factor) (CTF) (Nuclear factor I/B) (NF I/B) (NFI B) (TGGCA binding protein)
  • Length: 420  
  • Mass: 47442
• Sequence:

  MMYSPICLTQDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQKWASR
  LLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGER
  LMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVR
  VSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGS
  RTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILP
  PAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQSWYLG

• Structural information:
  • Interpro: IPR000647  IPR020604  IPR019739  IPR019548  IPR003619  
  • Prosite: PS00349 PS51080
  • DIP: 61433
  • STRING: ENSP00000370340
• Other Databases: GeneCards:  NFIB  Malacards:  NFIB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0007420	brain development	IMP	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006260	DNA replication	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003690	double-stranded DNA binding	IEA	molecular function
GO:2000795	negative regulation of epithelial cell proliferation involved in lung morphogenesis	IEA	biological process
GO:0071679	commissural neuron axon guidance	IEA	biological process
GO:0060662	salivary gland cavitation	IEA	biological process
GO:0060510	type II pneumocyte differentiation	IEA	biological process
GO:0060486	club cell differentiation	IEA	biological process
GO:0044300	cerebellar mossy fiber	IEA	cellular component
GO:0021740	principal sensory nucleus of trigeminal nerve development	IEA	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:2000791	negative regulation of mesenchymal cell proliferation involved in lung development	IEA	biological process
GO:0061141	lung ciliated cell differentiation	IEA	biological process
GO:0060689	cell differentiation involved in salivary gland development	IEA	biological process
GO:0060509	type I pneumocyte differentiation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0030902	hindbrain development	IEA	biological process
GO:0030900	forebrain development	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0021960	anterior commissure morphogenesis	IEA	biological process
GO:0010001	glial cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0002062	chondrocyte differentiation	IEA	biological process
GO:1902894	negative regulation of pri-miRNA transcription by RNA polymerase II	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0003677	DNA binding	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	molecular function
GO:2000791	negative regulation of mesenchymal cell proliferation involved in lung development	ISS	biological process
GO:0021960	anterior commissure morphogenesis	ISS	biological process
GO:0010001	glial cell differentiation	ISS	biological process
GO:2000795	negative regulation of epithelial cell proliferation involved in lung morphogenesis	ISS	biological process
GO:0071679	commissural neuron axon guidance	ISS	biological process
GO:0060510	type II pneumocyte differentiation	ISS	biological process
GO:0044300	cerebellar mossy fiber	ISS	cellular component
GO:0021740	principal sensory nucleus of trigeminal nerve development	ISS	biological process
GO:0061141	lung ciliated cell differentiation	ISS	biological process
GO:0060509	type I pneumocyte differentiation	ISS	biological process
GO:0002062	chondrocyte differentiation	ISS	biological process
GO:0060486	club cell differentiation	ISS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray