• Gene id: 4776

Gene Summary

• Gene Symbol: NFATC4   Gene   UCSC   Ensembl
• Aliases: NF-AT3, NF-ATC4, NFAT3
• Gene name: nuclear factor of activated T cells 4
• Alternate names: nuclear factor of activated T-cells, cytoplasmic 4, T-cell transcription factor NFAT3, nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4,
• Gene location: 14q12 (24366910: 24379603)     Exons: 12     NC_000014.9
• Gene summary(Entrez): This gene encodes a member of the nuclear factor of activated T cells (NFAT) protein family. The encoded protein is part of a DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that trans
• OMIM: 613973

Protein Summary

• Protein general information: Q14934  
  • Name: Nuclear factor of activated T cells, cytoplasmic 4 (NF ATc4) (NFATc4) (T cell transcription factor NFAT3) (NF AT3)
  • Length: 902  
  • Mass: 95449
  • Tissue specificity: Widely expressed, with high levels in placenta, lung, kidney, testis and ovary (PubMed
• Sequence:

  MGAASCEDEELEFKLVFGEEKEAPPLGAGGLGEELDSEDAPPCCRLALGEPPPYGAAPIGIPRPPPPRPGMHSPP
  PRPAPSPGTWESQPARSVRLGGPGGGAGGAGGGRVLECPSIRITSISPTPEPPAALEDNPDAWGDGSPRDYPPPE
  GFGGYREAGGQGGGAFFSPSPGSSSLSSWSFFSDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPW
  TPEDPWSLYGPSPGGRGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGSEPPPP
  PPLPLARDPGSPGPFDYVGAPPAESIPQKTRRTSSEQAVALPRSEEPASCNGKLPLGAEESVAPPGGSRKEVAGM
  DYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELRIEVQPRAHHRAHYETEGSRGAVKAAPGGHP
  VVKLLGYSEKPLTLQMFIGTADERNLRPHAFYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAG
  ILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQGGGKVVSVQAASVPIECSQRSAQELPQVEAYSPSACSVRG
  GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSRPVQVYFYVSNGRRKR
  SPTQSFRFLPVICKEEPLPDSSLRGFPSASATPFGTDMDFSPPRPPYPSYPHEDPACETPYLSEGFGYGMPPLYP
  QTGPPPSYRPGLRMFPETRGTTGCAQPPAVSFLPRPFPSDPYGGRGSSFSLGLPFSPPAPFRPPPLPASPPLEGP
  FPSQSDVHPLPAEGYNKVGPGYGPGEGAPEQEKSRGGYSSGFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGEEP
  PA

• Structural information:
  • Protein Domains: (401..58-)
    (/note="RHD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00265-)
    (586..68-)
    (/note="IPT/TIG"-)
  • Interpro: IPR013783  IPR014756  IPR002909  IPR008366  IPR008967   IPR032397  IPR011539  IPR037059  
  • Prosite: PS50254
  • PDB: 2YRP
  • PDBsum: 2YRP
  • STRING: ENSP00000388910
• Other Databases: GeneCards:  NFATC4  Malacards:  NFATC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0001816	cytokine production	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0008134	transcription factor binding	IBA	molecular function
GO:0033173	calcineurin-NFAT signaling cascade	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0003682	chromatin binding	IBA	molecular function
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0060291	long-term synaptic potentiation	ISS	biological process
GO:0007616	long-term memory	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043524	negative regulation of neuron apoptotic process	ISS	biological process
GO:0031547	brain-derived neurotrophic factor receptor signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0071285	cellular response to lithium ion	IEA	biological process
GO:0060291	long-term synaptic potentiation	IEA	biological process
GO:0045333	cellular respiration	IEA	biological process
GO:0032091	negative regulation of protein binding	IEA	biological process
GO:0007616	long-term memory	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:1904637	cellular response to ionomycin	IEA	biological process
GO:0048167	regulation of synaptic plasticity	IEA	biological process
GO:0042975	peroxisome proliferator activated receptor binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:2001235	positive regulation of apoptotic signaling pathway	IEA	biological process
GO:2000297	negative regulation of synapse maturation	IEA	biological process
GO:0055001	muscle cell development	IEA	biological process
GO:0051145	smooth muscle cell differentiation	IEA	biological process
GO:0050774	negative regulation of dendrite morphogenesis	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0035562	negative regulation of chromatin binding	IEA	biological process
GO:0034644	cellular response to UV	IEA	biological process
GO:0033173	calcineurin-NFAT signaling cascade	IEA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IEA	biological process
GO:0031547	brain-derived neurotrophic factor receptor signaling pathway	IEA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0007507	heart development	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001569	branching involved in blood vessel morphogenesis	IEA	biological process
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IGI	molecular function
GO:1902894	negative regulation of pri-miRNA transcription by RNA polymerase II	IGI	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0001816	cytokine production	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0008134	transcription factor binding	IBA	molecular function
GO:0033173	calcineurin-NFAT signaling cascade	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0003682	chromatin binding	IBA	molecular function
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0060291	long-term synaptic potentiation	ISS	biological process
GO:0007616	long-term memory	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043524	negative regulation of neuron apoptotic process	ISS	biological process
GO:0031547	brain-derived neurotrophic factor receptor signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0071285	cellular response to lithium ion	IEA	biological process
GO:0060291	long-term synaptic potentiation	IEA	biological process
GO:0045333	cellular respiration	IEA	biological process
GO:0032091	negative regulation of protein binding	IEA	biological process
GO:0007616	long-term memory	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:1904637	cellular response to ionomycin	IEA	biological process
GO:0048167	regulation of synaptic plasticity	IEA	biological process
GO:0042975	peroxisome proliferator activated receptor binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:2001235	positive regulation of apoptotic signaling pathway	IEA	biological process
GO:2000297	negative regulation of synapse maturation	IEA	biological process
GO:0055001	muscle cell development	IEA	biological process
GO:0051145	smooth muscle cell differentiation	IEA	biological process
GO:0050774	negative regulation of dendrite morphogenesis	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0035562	negative regulation of chromatin binding	IEA	biological process
GO:0034644	cellular response to UV	IEA	biological process
GO:0033173	calcineurin-NFAT signaling cascade	IEA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IEA	biological process
GO:0031547	brain-derived neurotrophic factor receptor signaling pathway	IEA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0007507	heart development	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001569	branching involved in blood vessel morphogenesis	IEA	biological process
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IGI	molecular function
GO:1902894	negative regulation of pri-miRNA transcription by RNA polymerase II	IGI	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05166	Human T-cell leukemia virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa04360	Axon guidance
hsa05170	Human immunodeficiency virus 1 infection
hsa04310	Wnt signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04921	Oxytocin signaling pathway
hsa04218	Cellular senescence
hsa05161	Hepatitis B
hsa04625	C-type lectin receptor signaling pathway

Diseases

Associated diseases	References
Cardiomyopathy	PMID:12939651
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881