• Gene id: 4759

Gene Summary

• Gene Symbol: NEU2   Gene   UCSC   Ensembl
• Aliases: SIAL2
• Gene name: neuraminidase 2
• Alternate names: sialidase-2, N-acetyl-alpha-neuraminidase 2, cytosolic sialidase, sialidase 2 (cytosolic sialidase),
• Gene location: 2q37.1 (233032671: 233035056)     Exons: 2     NC_000002.12
• Gene summary(Entrez): This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonst
• OMIM: 604546

Protein Summary

• Protein general information: Q9Y3R4  
  • Name: Sialidase 2 (EC 3.2.1.18) (Cytosolic sialidase) (N acetyl alpha neuraminidase 2)
  • Length: 380  
  • Mass: 42254
  • Tissue specificity: Expressed in skeletal muscle, fetal liver and embryonic carcinoma cell line NT2-D1. {ECO
• Sequence:

  MASLPVLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTHQVQWQAQEVVA
  QARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRLCQVTSTDHGRTWSSPRDLTDAAIGPA
  YREWSTFAVGPGHCLQLHDRARSLVVPAYAYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVE
  TGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTH
  SWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQAFPA
  EYLPQ

• Structural information:
  • Interpro: IPR011040  IPR026945  IPR026856  IPR036278  
  • PDB: 1SNT 1SO7 1VCU 2F0Z 2F10 2F11 2F12 2F13 2F24 2F25 2F26 2F27 2F28 2F29 4NC5 4NCS
  • PDBsum: 1SNT 1SO7 1VCU 2F0Z 2F10 2F11 2F12 2F13 2F24 2F25 2F26 2F27 2F28 2F29 4NC5 4NCS
  • STRING: ENSP00000233840
• Other Databases: GeneCards:  NEU2  Malacards:  NEU2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004308	exo-alpha-sialidase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0009313	oligosaccharide catabolic process	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0005764	lysosome	IBA	cellular component
GO:0006689	ganglioside catabolic process	IBA	biological process
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0009313	oligosaccharide catabolic process	IDA	biological process
GO:0052794	exo-alpha-(2->3)-sialidase activity	IDA	molecular function
GO:0006689	ganglioside catabolic process	IDA	biological process
GO:0004308	exo-alpha-sialidase activity	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0008152	metabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016798	hydrolase activity, acting on glycosyl bonds	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016042	lipid catabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0052794	exo-alpha-(2->3)-sialidase activity	IEA	molecular function
GO:0004308	exo-alpha-sialidase activity	IEA	molecular function
GO:0052796	exo-alpha-(2->8)-sialidase activity	IEA	molecular function
GO:0052795	exo-alpha-(2->6)-sialidase activity	IEA	molecular function
GO:0004308	exo-alpha-sialidase activity	TAS	molecular function
GO:0004308	exo-alpha-sialidase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006687	glycosphingolipid metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0051692	cellular oligosaccharide catabolic process	IDA	biological process
GO:1902494	catalytic complex	IDA	cellular component
GO:0004308	exo-alpha-sialidase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00600	Sphingolipid metabolism
hsa00511	Other glycan degradation

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq