• Gene id: 4758

Gene Summary

• Gene Symbol: NEU1   Gene   UCSC   Ensembl
• Aliases: NANH, NEU, SIAL1
• Gene name: neuraminidase 1
• Alternate names: sialidase-1, G9 sialidase, N-acetyl-alpha-neuraminidase 1, acetylneuraminyl hydrolase, exo-alpha-sialidase, lysosomal sialidase, sialidase 1 (lysosomal sialidase),
• Gene location: 6p21.33 (31862820: 31857658)     Exons: 6     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a lysosomal enzyme that cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and
• OMIM: 605907

Protein Summary

• Protein general information: Q99519  
  • Name: Sialidase 1 (EC 3.2.1.18) (Acetylneuraminyl hydrolase) (G9 sialidase) (Lysosomal sialidase) (N acetyl alpha neuraminidase 1)
  • Length: 415  
  • Mass: 45467
  • Tissue specificity: Highly expressed in pancreas, followed by skeletal muscle, kidney, placenta, heart, lung and liver. Weakly expressed in brain. {ECO
• Sequence:

  MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKAENDFGLVQPLVTMEQLLWVSGRQIGSVD
  TFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGV
  VFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLER
  DGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACD
  TLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLAT
  LEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL

• Structural information:
  • Interpro: IPR011040  IPR026856  IPR036278  
  • STRING: ENSP00000364782
• Other Databases: GeneCards:  NEU1  Malacards:  NEU1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004308	exo-alpha-sialidase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0009313	oligosaccharide catabolic process	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0005764	lysosome	IBA	cellular component
GO:0006689	ganglioside catabolic process	IBA	biological process
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0004308	exo-alpha-sialidase activity	IDA	molecular function
GO:0016997	alpha-sialidase activity	IMP	molecular function
GO:0009313	oligosaccharide catabolic process	IMP	biological process
GO:0004308	exo-alpha-sialidase activity	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016042	lipid catabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016798	hydrolase activity, acting on glycosyl bonds	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0052794	exo-alpha-(2->3)-sialidase activity	IEA	molecular function
GO:0052796	exo-alpha-(2->8)-sialidase activity	IEA	molecular function
GO:0004308	exo-alpha-sialidase activity	IEA	molecular function
GO:0052795	exo-alpha-(2->6)-sialidase activity	IEA	molecular function
GO:0004308	exo-alpha-sialidase activity	TAS	molecular function
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0006687	glycosphingolipid metabolic process	TAS	biological process
GO:0035580	specific granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0004308	exo-alpha-sialidase activity	IEA	molecular function
GO:0043202	lysosomal lumen	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0004308	exo-alpha-sialidase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0009313	oligosaccharide catabolic process	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0005764	lysosome	IBA	cellular component
GO:0006689	ganglioside catabolic process	IBA	biological process
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0004308	exo-alpha-sialidase activity	IDA	molecular function
GO:0016997	alpha-sialidase activity	IMP	molecular function
GO:0009313	oligosaccharide catabolic process	IMP	biological process
GO:0004308	exo-alpha-sialidase activity	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016042	lipid catabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016798	hydrolase activity, acting on glycosyl bonds	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0052794	exo-alpha-(2->3)-sialidase activity	IEA	molecular function
GO:0052796	exo-alpha-(2->8)-sialidase activity	IEA	molecular function
GO:0004308	exo-alpha-sialidase activity	IEA	molecular function
GO:0052795	exo-alpha-(2->6)-sialidase activity	IEA	molecular function
GO:0004308	exo-alpha-sialidase activity	TAS	molecular function
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0006687	glycosphingolipid metabolic process	TAS	biological process
GO:0035580	specific granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0004308	exo-alpha-sialidase activity	IEA	molecular function
GO:0043202	lysosomal lumen	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04142	Lysosome
hsa00600	Sphingolipid metabolism
hsa00511	Other glycan degradation

Diseases

Associated diseases	References
Glycoproteinoses	KEGG:H00422
Sialidosis	KEGG:H00142
Glycoproteinoses	KEGG:H00422
Sialidosis	KEGG:H00142
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881