• Gene id: 4752

Gene Summary

• Gene Symbol: NEK3   Gene   UCSC   Ensembl
• Aliases: HSPK36
• Gene name: NIMA related kinase 3
• Alternate names: serine/threonine-protein kinase Nek3, HSPK 36, NIMA (never in mitosis gene a)-related kinase 3, glycogen synthase A kinase, hydroxyalkyl-protein kinase, never in mitosis A-related kinase 3, nimA-related protein kinase 3, phosphorylase B kinase kinase,
• Gene location: 13q14.3 (113349540: 113371232)     Exons: 6     NC_000009.12
• Gene summary(Entrez): This gene encodes a member of the NimA (never in mitosis A) family of serine/threonine protein kinases. The encoded protein differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. The kinase i
• OMIM: 604044

Protein Summary

• Protein general information: P51956  
  • Name: Serine/threonine protein kinase Nek3 (EC 2.7.11.1) (HSPK 36) (Never in mitosis A related kinase 3) (NimA related protein kinase 3)
  • Length: 506  
  • Mass: 57705
  • Tissue specificity: Up-regulated in malignant versus normal breast tissue. Isoform 2 shows a high level of expression in testis, ovary and brain. {ECO
• Sequence:

  MDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAVLLAKMKHPNIVAFKESFEAEGHL
  YIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSAR
  LLSNPMAFACTYVGTPYYVPPEIWENLPYNNKSDIWSLGCILYELCTLKHPFQANSWKNLILKVCQGCISPLPSH
  YSYELQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQKCLPPEIIMEYGEEVLEEIKNSKHNTPRKKTNPSRIRI
  ALGNEASTVQEEEQDRKGSHTDLESINENLVESALRRVNREEKGNKSVHLRKASSPNLHRRQWEKNVPNTALTAL
  ENASILTSSLTAEDDRGGSVIKYSKNTTRKQWLKETPDTLLNILKNADLSLAFQTYTIYRPGSEGFLKGPLSEET
  EASDSVDGGHDSVILDPERLEPGLDEEDTDFEEEDDNPDWVSELKKRAGWQGLCDR

• Structural information:
  • Protein Domains: (4..25-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • STRING: ENSP00000484443
• Other Databases: GeneCards:  NEK3  Malacards:  NEK3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006468	protein phosphorylation	ISS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030010	establishment of cell polarity	IEA	biological process
GO:0090043	regulation of tubulin deacetylation	IEA	biological process
GO:0048812	neuron projection morphogenesis	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000278	mitotic cell cycle	NAS	biological process
GO:0005634	nucleus	NAS	cellular component
GO:0004674	protein serine/threonine kinase activity	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq