• Gene id: 4751

Gene Summary

• Gene Symbol: NEK2   Gene   UCSC   Ensembl
• Aliases: HsPK21, NEK2A, NLK1, PPP1R111, RP67
• Gene name: NIMA related kinase 2
• Alternate names: serine/threonine-protein kinase Nek2, NIMA (never in mitosis gene a)-related kinase 2, nimA-like protein kinase 1, nimA-related protein kinase 2, protein phosphatase 1, regulatory subunit 111,
• Gene location: 1q32.3 (211675629: 211658255)     Exons: 9     NC_000001.11
• Gene summary(Entrez): This gene encodes a serine/threonine-protein kinase that is involved in mitotic regulation. This protein is localized to the centrosome, and undetectable during G1 phase, but accumulates progressively throughout the S phase, reaching maximal levels in lat
• OMIM: 138275

Protein Summary

• Protein general information: P51955  
  • Name: Serine/threonine protein kinase Nek2 (EC 2.7.11.1) (HSPK 21) (Never in mitosis A related kinase 2) (NimA related protein kinase 2) (NimA like protein kinase 1)
  • Length: 445  
  • Mass: 51763
  • Tissue specificity: Isoform 1 and isoform 2 are expressed in peripheral blood T-cells and a wide variety of transformed cell types. Isoform 1 and isoform 4 are expressed in the testis. Up-regulated in various cancer cell lines, as well as primary breast t
• Sequence:

  MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRII
  DRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLD
  GKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELA
  GKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPEKSQDSS
  PVLSELKLKEIQLQERERALKAREERLEQKEQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNPELLNL
  PSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAAQLRAQALSDIEKNYQLKSRQILGMR

• Structural information:
  • Protein Domains: (8..27-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR008271  
  • Prosite: PS50011 PS00108
  • PDB: 2JAV 2W5A 2W5B 2W5H 2WQO 2XK3 2XK4 2XK6 2XK7 2XK8 2XKC 2XKD 2XKE 2XKF 2XNM 2XNN 2XNO 2XNP 4A4X 4AFE 5M51 5M53 5M55 5M57 6H0O
  • PDBsum: 2JAV 2W5A 2W5B 2W5H 2WQO 2XK3 2XK4 2XK6 2XK7 2XK8 2XKC 2XKD 2XKE 2XKF 2XNM 2XNN 2XNO 2XNP 4A4X 4AFE 5M51 5M53 5M55 5M57 6H0O
  • STRING: ENSP00000355966
• Other Databases: GeneCards:  NEK2  Malacards:  NEK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005813	centrosome	IBA	cellular component
GO:0007059	chromosome segregation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0000776	kinetochore	IDA	colocalizes with
GO:0005813	centrosome	IDA	cellular component
GO:0007059	chromosome segregation	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0051988	regulation of attachment of spindle microtubules to kinetochore	IMP	biological process
GO:0046602	regulation of mitotic centrosome separation	TAS	biological process
GO:0046602	regulation of mitotic centrosome separation	IMP	biological process
GO:0051225	spindle assembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0007059	chromosome segregation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0007088	regulation of mitotic nuclear division	TAS	biological process
GO:0005813	centrosome	TAS	cellular component
GO:0000278	mitotic cell cycle	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0010389	regulation of G2/M transition of mitotic cell cycle	TAS	biological process
GO:0097711	ciliary basal body-plasma membrane docking	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000794	condensed nuclear chromosome	IEA	cellular component
GO:0001824	blastocyst development	IEA	biological process
GO:0090307	mitotic spindle assembly	IEA	biological process
GO:0000070	mitotic sister chromatid segregation	IEA	biological process
GO:0000922	spindle pole	IEA	cellular component
GO:0004672	protein kinase activity	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007059	chromosome segregation	IEA	biological process
GO:0030496	midbody	IEA	cellular component
GO:0043392	negative regulation of DNA binding	IEA	biological process
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:1904355	positive regulation of telomere capping	IMP	biological process
GO:0051973	positive regulation of telomerase activity	IMP	biological process
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0051299	centrosome separation	IDA	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0004672	protein kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006468	protein phosphorylation	IMP	biological process
GO:0004672	protein kinase activity	IMP	molecular function
GO:1903126	negative regulation of centriole-centriole cohesion	IMP	biological process
GO:0046777	protein autophosphorylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032991	protein-containing complex	IMP	cellular component
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Retinitis pigmentosa	KEGG:H00527
Retinitis pigmentosa	KEGG:H00527
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray