• Gene id: 4738

Gene Summary

• Gene Symbol: NEDD8   Gene   UCSC   Ensembl
• Aliases: NEDD-8
• Gene name: NEDD8 ubiquitin like modifier
• Alternate names: NEDD8, neddylin, neural precursor cell expressed, developmentally down-regulated 8, ubiquitin-like protein Nedd8,
• Gene location: 14q12 (24232366: 24216856)     Exons: 4     NC_000014.9
• OMIM: 603171

Protein Summary

• Protein general information: Q15843  
  • Name: NEDD8 (Neddylin) (Neural precursor cell expressed developmentally down regulated protein 8) (NEDD 8) (Ubiquitin like protein Nedd8)
  • Length: 81  
  • Mass: 9072
  • Tissue specificity: Highly expressed in heart, skeletal muscle, spleen, thymus, prostate, testis, ovary, colon and leukocytes. {ECO
• Sequence:

  MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRG
  GGGLRQ

• Structural information:
  • Interpro: IPR038738  IPR000626  IPR029071  IPR019954  IPR019956  
  • Prosite: PS00299 PS50053
  • CDD: cd01806
  • PDB: 1NDD 1R4M 1R4N 1XT9 2BKR 2KO3 2N7K 2NVU 3DBH 3DBL 3DBR 3DQV 3GZN 4F8C 4FBJ 4HCP 4P5O 6R7F 6R7I
  • PDBsum: 1NDD 1R4M 1R4N 1XT9 2BKR 2KO3 2N7K 2NVU 3DBH 3DBL 3DBR 3DQV 3GZN 4F8C 4FBJ 4HCP 4P5O 6R7F 6R7I
  • DIP: 29266
  • STRING: ENSP00000250495
• Other Databases: GeneCards:  NEDD8  Malacards:  NEDD8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031386	protein tag	IBA	molecular function
GO:0031625	ubiquitin protein ligase binding	IBA	molecular function
GO:0045116	protein neddylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0016567	protein ubiquitination	IBA	NOT|biological process
GO:0019941	modification-dependent protein catabolic process	IBA	biological process
GO:0030162	regulation of proteolysis	IBA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0006464	cellular protein modification process	TAS	biological process
GO:0006508	proteolysis	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0045116	protein neddylation	IDA	biological process
GO:0016567	protein ubiquitination	TAS	biological process
GO:0016567	protein ubiquitination	TAS	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006879	cellular iron ion homeostasis	TAS	biological process
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045116	protein neddylation	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008104	protein localization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Parkinson's disease	PMID:12533840
Astrocytoma	PMID:12533840
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)