• Gene id: 4734

Gene Summary

• Gene Symbol: NEDD4   Gene   UCSC   Ensembl
• Aliases: NEDD4-1, RPF1
• Gene name: NEDD4 E3 ubiquitin protein ligase
• Alternate names: E3 ubiquitin-protein ligase NEDD4, HECT-type E3 ubiquitin transferase NEDD4, cell proliferation-inducing gene 53 protein, neural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitin protein ligase, receptor-potentiating factor 1,
• Gene location: 15q21.3 (55993611: 55826916)     Exons: 33     NC_000015.10
• Gene summary(Entrez): This gene is the founding member of the NEDD4 family of HECT ubiquitin ligases that function in the ubiquitin proteasome system of protein degradation. The encoded protein contains an N-terminal calcium and phospholipid binding C2 domain followed by multi
• OMIM: 602278

Protein Summary

• Protein general information: P46934  
  • Name: E3 ubiquitin protein ligase NEDD4 (EC 2.3.2.26) (Cell proliferation inducing gene 53 protein) (HECT type E3 ubiquitin transferase NEDD4) (Neural precursor cell expressed developmentally down regulated protein 4) (NEDD 4)
  • Length: 1319  
  • Mass: 149114
• Sequence:

  MAQSLRLHFAARRSNTYPLSETSGDDLDSHVHMCFKRPTRISTSNVVQMKLTPRQTALAPLIKENVQSQERSSVP
  SSENVNKKSSCLQISLQPTRYSGYLQSSNVLADSDDASFTCILKDGIYSSAVVDNELNAVNDGHLVSSPAICSGS
  LSNFSTSDNGSYSSNGSDFGSCASITSGGSYTNSVISDSSSYTFPPSDDTFLGGNLPSDSTSNRSVPNRNTTPCE
  IFSRSTSTDPFVQDDLEHGLEIMKLPVSRNTKIPLKRYSSLVIFPRSPSTTRPTSPTSLCTLLSKGSYQTSHQFI
  ISPSEIAHNEDGTSAKGFLSTAVNGLRLSKTICTPGEVRDIRPLHRKGSLQKKIVLSNNTPRQTVCEKSSEGYSC
  VSVHFTQRKAATLDCETTNGDCKPEMSEIKLNSDSEYIKLMHRTSACLPSSQNVDCQININGELERPHSQMNKNH
  GILRRSISLGGAYPNISCLSSLKHNCSKGGPSQLLIKFASGNEGKVDNLSRDSNRDCTNELSNSCKTRDDFLGQV
  DVPLYPLPTENPRLERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDAA
  CHLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDNLTDAENGNIQLQAQRAFTTRRQISEETES
  VDNRESSENWEIIREDEATMYSNQAFPSPPPSSNLDVPTHLAEELNARLTIFGNSAVSQPASSSNHSSRRGSLQA
  YTFEEQPTLPVLLPTSSGLPPGWEEKQDERGRSYYVDHNSRTTTWTKPTVQATVETSQLTSSQSSAGPQSQASTS
  DSGQQVTQPSEIEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDTSNDLGPLPPGWEE
  RTHTDGRIFYINHNIKRTQWEDPRLENVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIPNKFEMKLRRATVLEDS
  YRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDH
  LSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEEL
  FGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLG
  DVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWG
  TPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD

• Structural information:
  • Protein Domains: (610..64-)
    (/note="WW-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00224-)
    (767..80-)
    (/note="WW-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00224-)
    (840..87-)
    (/note="WW-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00224-)
    (-)
  • Interpro: IPR035892  IPR000569  IPR035983  IPR001202  IPR036020  
  • Prosite: PS50237 PS01159 PS50020
  • CDD: cd00078 cd00201
  • PDB: 2KPZ 2KQ0 2M3O 2XBB 2XBF 3B7Y 4BBN 4BE8 4N7F 4N7H 5AHT 5C7J 5C91
  • PDBsum: 2KPZ 2KQ0 2M3O 2XBB 2XBF 3B7Y 4BBN 4BE8 4N7F 4N7H 5AHT 5C7J 5C91
  • DIP: 29815
  • STRING: ENSP00000424827
• Other Databases: GeneCards:  NEDD4  Malacards:  NEDD4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045732	positive regulation of protein catabolic process	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000151	ubiquitin ligase complex	IEA	cellular component
GO:0003197	endocardial cushion development	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0007528	neuromuscular junction development	IEA	biological process
GO:0030948	negative regulation of vascular endothelial growth factor receptor signaling pathway	IEA	biological process
GO:0035255	ionotropic glutamate receptor binding	IEA	molecular function
GO:0042110	T cell activation	IEA	biological process
GO:0045732	positive regulation of protein catabolic process	IEA	biological process
GO:0048514	blood vessel morphogenesis	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0003151	outflow tract morphogenesis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006513	protein monoubiquitination	IEA	biological process
GO:0010766	negative regulation of sodium ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0019871	sodium channel inhibitor activity	IEA	molecular function
GO:0043197	dendritic spine	IEA	cellular component
GO:0048814	regulation of dendrite morphogenesis	IEA	biological process
GO:0050807	regulation of synapse organization	IEA	biological process
GO:0050815	phosphoserine residue binding	IEA	molecular function
GO:0050816	phosphothreonine residue binding	IEA	molecular function
GO:0070064	proline-rich region binding	IEA	molecular function
GO:0099524	postsynaptic cytosol	IEA	cellular component
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0070063	RNA polymerase binding	IPI	molecular function
GO:0019871	sodium channel inhibitor activity	IDA	molecular function
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050815	phosphoserine residue binding	ISS	molecular function
GO:0050816	phosphothreonine residue binding	ISS	molecular function
GO:0070064	proline-rich region binding	IMP	molecular function
GO:0005938	cell cortex	IDA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0000151	ubiquitin ligase complex	ISS	cellular component
GO:0005829	cytosol	ISS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0010768	negative regulation of transcription from RNA polymerase II promoter in response to UV-induced DNA damage	IMP	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IMP	biological process
GO:0046755	viral budding	IMP	biological process
GO:0031175	neuron projection development	IEP	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0051592	response to calcium ion	TAS	biological process
GO:0000785	chromatin	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0034765	regulation of ion transmembrane transport	IDA	biological process
GO:0042391	regulation of membrane potential	IDA	biological process
GO:0042921	glucocorticoid receptor signaling pathway	IDA	biological process
GO:0046824	positive regulation of nucleocytoplasmic transport	IDA	biological process
GO:0050847	progesterone receptor signaling pathway	IDA	biological process
GO:1901016	regulation of potassium ion transmembrane transporter activity	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:2000650	negative regulation of sodium ion transmembrane transporter activity	IDA	biological process
GO:0005886	plasma membrane	IMP	cellular component
GO:0016327	apicolateral plasma membrane	TAS	cellular component
GO:0034644	cellular response to UV	IMP	biological process
GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0031698	beta-2 adrenergic receptor binding	IDA	molecular function
GO:0010766	negative regulation of sodium ion transport	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0031623	receptor internalization	IDA	biological process
GO:0007041	lysosomal transport	IDA	biological process
GO:0006622	protein targeting to lysosome	IDA	biological process
GO:0032801	receptor catabolic process	IDA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070064	proline-rich region binding	IPI	molecular function
GO:0044111	development involved in symbiotic interaction	IMP	biological process
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0045732	positive regulation of protein catabolic process	IBA	biological process
GO:0032801	receptor catabolic process	IBA	biological process
GO:0031175	neuron projection development	IBA	biological process
GO:0007528	neuromuscular junction development	IBA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:2000650	negative regulation of sodium ion transmembrane transporter activity	IBA	biological process
GO:0050807	regulation of synapse organization	IBA	biological process
GO:0048814	regulation of dendrite morphogenesis	IBA	biological process
GO:0043197	dendritic spine	IBA	cellular component
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0031623	receptor internalization	IBA	biological process
GO:0019871	sodium channel inhibitor activity	IBA	molecular function
GO:0016567	protein ubiquitination	IBA	biological process
GO:0006622	protein targeting to lysosome	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0070534	protein K63-linked ubiquitination	ISS	biological process
GO:0030948	negative regulation of vascular endothelial growth factor receptor signaling pathway	ISS	biological process
GO:0048814	regulation of dendrite morphogenesis	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004842	ubiquitin-protein transferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa05169	Epstein-Barr virus infection
hsa04120	Ubiquitin mediated proteolysis
hsa04530	Tight junction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq