• Gene id: 4733

Gene Summary

• Gene Symbol: DRG1   Gene   UCSC   Ensembl
• Aliases: NEDD3
• Gene name: developmentally regulated GTP binding protein 1
• Alternate names: developmentally-regulated GTP-binding protein 1, DRG-1, NEDD-3, TRAFAC GTPase DRG1, neural precursor cell expressed developmentally down-regulated protein 3, neural precursor cell expressed, developmentally down-regulated 3, translation factor GTPase DRG1,
• Gene location: 22q12.2 (75205435: 75235758)     Exons: 23     NC_000017.11
• OMIM: 603952

Protein Summary

• Protein general information: Q9Y295  
  • Name: Developmentally regulated GTP binding protein 1 (DRG 1) (Neural precursor cell expressed developmentally down regulated protein 3) (NEDD 3) (Translation factor GTPase DRG1) (TRAFAC GTPase DRG1) (EC 3.6.5. )
  • Length: 367  
  • Mass: 40542
  • Tissue specificity: High levels in skeletal muscle, heart, and kidney. Intermediate levels in liver, placenta and brain. Low levels in colon, thymus, spleen, small intestine, lung and leukocytes. {ECO
• Sequence:

  MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSV
  GKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLD
  VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDA
  TADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKG
  QLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK

• Structural information:
  • Protein Domains: (65..29-)
    (/note="OBG-type-G)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01047-)
    (290..36-)
    (/note="TGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01228,-ECO:0000303|PubMed:23711155")
  • Interpro: IPR012675  IPR031167  IPR031662  IPR006074  IPR006073   IPR027417  IPR005225  IPR004095  IPR012676  
  • Prosite: PS51710 PS00905 PS51880
  • PDB: 2EKI
  • PDBsum: 2EKI
  • STRING: ENSP00000329715
• Other Databases: GeneCards:  DRG1  Malacards:  DRG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0002181	cytoplasmic translation	IBA	biological process
GO:0005525	GTP binding	IBA	molecular function
GO:0008017	microtubule binding	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0030955	potassium ion binding	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:1901673	regulation of mitotic spindle assembly	IMP	biological process
GO:0031116	positive regulation of microtubule polymerization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0008134	transcription factor binding	TAS	molecular function
GO:0006351	transcription, DNA-templated	TAS	biological process
GO:0007275	multicellular organism development	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005844	polysome	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R