• Gene id: 4701

Gene Summary

• Gene Symbol: NDUFA7   Gene   UCSC   Ensembl
• Aliases: B14.5a, CI-B14.5a
• Gene name: NADH:ubiquinone oxidoreductase subunit A7
• Alternate names: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa, NADH-ubiquinone oxidoreductase subunit B14.5a, complex I B14.5a subunit,
• Gene location: 19p13.2 (8321412: 8308602)     Exons: 1     NC_000019.10
• Gene summary(Entrez): This gene encodes a subunit of NADH:ubiquinone oxidoreductase (complex I), which is a multiprotein complex located in the inner mitochondrial membrane. Complex I functions in the transfer of electrons from NADH to the respiratory chain. [provided by RefSe
• OMIM: 602139

Protein Summary

• Protein general information: O95182  
  • Name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 (Complex I B14.5a) (CI B14.5a) (NADH ubiquinone oxidoreductase subunit B14.5a)
  • Length: 113  
  • Mass: 12551
• Sequence:

  MASATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGRRESVPPSIIMSSQKA
  LVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL

• Structural information:
  • Interpro: IPR009947  
  • PDB: 5XTB 5XTD 5XTH 5XTI
  • PDBsum: 5XTB 5XTD 5XTH 5XTI
  • STRING: ENSP00000301457
• Other Databases: GeneCards:  NDUFA7  Malacards:  NDUFA7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006120	mitochondrial electron transport, NADH to ubiquinone	IBA	biological process
GO:0005747	mitochondrial respiratory chain complex I	IBA	cellular component
GO:0005747	mitochondrial respiratory chain complex I	IDA	cellular component
GO:0005747	mitochondrial respiratory chain complex I	IDA	cellular component
GO:0042773	ATP synthesis coupled electron transport	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0008137	NADH dehydrogenase (ubiquinone) activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0070469	respirasome	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0032981	mitochondrial respiratory chain complex I assembly	TAS	biological process
GO:0006120	mitochondrial electron transport, NADH to ubiquinone	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0006120	mitochondrial electron transport, NADH to ubiquinone	NAS	biological process
GO:0008137	NADH dehydrogenase (ubiquinone) activity	NAS	molecular function
GO:0005747	mitochondrial respiratory chain complex I	NAS	cellular component
GO:0032543	mitochondrial translation	ISS	biological process
GO:0005761	mitochondrial ribosome	ISS	cellular component
GO:0003735	structural constituent of ribosome	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05012	Parkinson disease
hsa04714	Thermogenesis
hsa04723	Retrograde endocannabinoid signaling
hsa00190	Oxidative phosphorylation
hsa04932	Non-alcoholic fatty liver disease

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)