• Gene id: 4692

Gene Summary

• Gene Symbol: NDN   Gene   UCSC   Ensembl
• Aliases: HsT16328, PWCR
• Gene name: necdin, MAGE family member
• Alternate names: necdin, Prader-Willi syndrome chromosome region, necdin homolog, necdin, melanoma antigen (MAGE) family member, necdin-like protein,
• Gene location: 15q11.2 (52278648: 52254423)     Exons: 9     NC_000003.12
• Gene summary(Entrez): This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic
• OMIM: 602117

Protein Summary

• Protein general information: Q99608  
  • Name: Necdin
  • Length: 321  
  • Mass: 36086
  • Tissue specificity: Almost ubiquitous. Detected in fetal brain, lung, liver and kidney; in adult heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine and colon. Not detected in pe
• Sequence:

  MSEQSKDLSDPNFAAEAPNSEVHSSPGVSEGVPPSATLAEPQSPPLGPTAAPQAAPPPQAPNDEGDPKALQQAAE
  EGRAHQAPSAAQPGPAPPAPAQLVQKAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSILRRTSLILARV
  FGLHLRLTSLHTMEFALVKALEPEELDRVALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKH
  STFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEE
  ARALREANPTAHYPRSSVSED

• Structural information:
  • Protein Domains: (98..29-)
    (/note="MAGE-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00127"-)
  • Interpro: IPR037445  IPR041898  IPR041899  IPR002190  IPR030086  
  • Prosite: PS50838
  • STRING: ENSP00000332643
• Other Databases: GeneCards:  NDN  Malacards:  NDN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0048666	neuron development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0040008	regulation of growth	IEA	biological process
GO:0007399	nervous system development	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0007413	axonal fasciculation	IEA	biological process
GO:0007585	respiratory gaseous exchange by respiratory system	IEA	biological process
GO:0019233	sensory perception of pain	IEA	biological process
GO:0043015	gamma-tubulin binding	IEA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0048011	neurotrophin TRK receptor signaling pathway	IEA	biological process
GO:0048666	neuron development	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0001764	neuron migration	IEA	biological process
GO:0003016	respiratory system process	IEA	biological process
GO:0005813	centrosome	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0007417	central nervous system development	IEA	biological process
GO:0008347	glial cell migration	IEA	biological process
GO:0009791	post-embryonic development	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0048675	axon extension	IEA	biological process
GO:0048871	multicellular organismal homeostasis	IEA	biological process
GO:0071514	genetic imprinting	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Prader-Willi syndrome	KEGG:H00478
Prader-Willi syndrome	KEGG:H00478
Prader-Willi syndrome	PMID:9630521
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881