Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 4690
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol NCK1   Gene   UCSC   Ensembl
Aliases NCK, NCKalpha, nck-1
Gene name NCK adaptor protein 1
Alternate names cytoplasmic protein NCK1, NCK tyrosine kinase, SH2/SH3 adaptor protein NCK-alpha, melanoma NCK protein, non-catalytic region of tyrosine kinase,
Gene location 3q22.3 (136862207: 136951605)     Exons: 6     NC_000003.12
Gene summary(Entrez) The protein encoded by this gene is one of the signaling and transforming proteins containing Src homology 2 and 3 (SH2 and SH3) domains. It is located in the cytoplasm and is an adaptor protein involved in transducing signals from receptor tyrosine kinas
OMIM 600508

Protein Summary
Protein general information P16333  

Name: Cytoplasmic protein NCK1 (NCK adaptor protein 1) (Nck 1) (SH2/SH3 adaptor protein NCK alpha)

Length: 377  Mass: 42864

Sequence MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKNLKDTL
GIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNG
QVGWFPSNYVTEEGDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPEN
DPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAPIFTSEQGEKLYLVKH
LS
Structural information
Protein Domains
 (2..6-)
(/note="SH3-1)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
(106..16-)
(/note="SH3-2)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
(190..25-)
(/note="SH3-3)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
(-)
Interpro:  IPR017304  IPR035882  IPR035562  IPR035564  IPR035565  
IPR000980  IPR036860  IPR036028  IPR001452  
Prosite:   PS50001 PS50002
CDD:   cd10408 cd11900 cd11901 cd11904

PDB:  		 2CI8 2CI9 2CUB 2JS0 2JS2 2JW4
PDBsum:   2CI8 2CI9 2CUB 2JS0 2JS2 2JW4

DIP:  
639
MINT:  
STRING:   ENSP00000417273
Other Databases GeneCards:  NCK1  Malacards:  NCK1

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:1990441 negative regulation of tr
anscription from RNA poly
merase II promoter in res
ponse to endoplasmic reti
culum stress
 IDA biological process
GO:0000164 protein phosphatase type
1 complex
 IDA cellular component
GO:0005783 endoplasmic reticulum
 IDA cellular component
GO:0005840 ribosome
 IDA cellular component
GO:0070262 peptidyl-serine dephospho
rylation
 IDA biological process
GO:0035591 signaling adaptor activit
y
 NAS molecular function
GO:0071074 eukaryotic initiation fac
tor eIF2 binding
 IPI molecular function
GO:0071074 eukaryotic initiation fac
tor eIF2 binding
 IPI molecular function
GO:1903679 positive regulation of ca
p-independent translation
al initiation
 IDA biological process
GO:1903898 negative regulation of PE
RK-mediated unfolded prot
ein response
 IDA biological process
GO:1903912 negative regulation of en
doplasmic reticulum stres
s-induced eIF2 alpha phos
phorylation
 IDA biological process
GO:1903912 negative regulation of en
doplasmic reticulum stres
s-induced eIF2 alpha phos
phorylation
 IDA biological process
GO:0033137 negative regulation of pe
ptidyl-serine phosphoryla
tion
 IDA biological process
GO:0033137 negative regulation of pe
ptidyl-serine phosphoryla
tion
 IDA biological process
GO:1903676 positive regulation of ca
p-dependent translational
initiation
 IDA biological process
GO:0030674 protein-macromolecule ada
ptor activity
 IC molecular function
GO:0036493 positive regulation of tr
anslation in response to
endoplasmic reticulum str
ess
 IDA biological process
GO:1902237 positive regulation of en
doplasmic reticulum stres
s-induced intrinsic apopt
otic signaling pathway
 IDA biological process
GO:0060548 negative regulation of ce
ll death
 IDA biological process
GO:0045944 positive regulation of tr
anscription by RNA polyme
rase II
 IDA biological process
GO:0004860 protein kinase inhibitor
activity
 IDA molecular function
GO:0030971 receptor tyrosine kinase
binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0006417 regulation of translation
 IEA biological process
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005737 cytoplasm
 TAS cellular component
GO:0030674 protein-macromolecule ada
ptor activity
 IDA molecular function
GO:0046627 negative regulation of in
sulin receptor signaling
pathway
 IMP biological process
GO:0005886 plasma membrane
 TAS cellular component
GO:0050852 T cell receptor signaling
pathway
 TAS biological process
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0038096 Fc-gamma receptor signali
ng pathway involved in ph
agocytosis
 TAS biological process
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:1990441 negative regulation of tr
anscription from RNA poly
merase II promoter in res
ponse to endoplasmic reti
culum stress
 IEA biological process
GO:1902237 positive regulation of en
doplasmic reticulum stres
s-induced intrinsic apopt
otic signaling pathway
 IEA biological process
GO:0051707 response to other organis
m
 IEA biological process
GO:0036493 positive regulation of tr
anslation in response to
endoplasmic reticulum str
ess
 IEA biological process
GO:0030838 positive regulation of ac
tin filament polymerizati
on
 IEA biological process
GO:0019904 protein domain specific b
inding
 IEA molecular function
GO:0010976 positive regulation of ne
uron projection developme
nt
 IEA biological process
GO:0006930 substrate-dependent cell
migration, cell extension
 IEA biological process
GO:1903912 negative regulation of en
doplasmic reticulum stres
s-induced eIF2 alpha phos
phorylation
 IEA biological process
GO:1903898 negative regulation of PE
RK-mediated unfolded prot
ein response
 IEA biological process
GO:0071074 eukaryotic initiation fac
tor eIF2 binding
 IEA molecular function
GO:0048013 ephrin receptor signaling
pathway
 IEA biological process
GO:0046875 ephrin receptor binding
 IEA molecular function
GO:0030334 regulation of cell migrat
ion
 IEA biological process
GO:0030032 lamellipodium assembly
 IEA biological process
GO:0016477 cell migration
 IEA biological process
GO:0012506 vesicle membrane
 IEA cellular component
GO:0007015 actin filament organizati
on
 IEA biological process
GO:0005911 cell-cell junction
 IEA cellular component
GO:0045296 cadherin binding
 HDA molecular function
GO:0005737 cytoplasm
 IDA cellular component
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005886 plasma membrane
 IDA cellular component
GO:0005829 cytosol
 IDA cellular component
GO:0006469 negative regulation of pr
otein kinase activity
 IEA biological process
GO:0042110 T cell activation
 IMP biological process
GO:0030159 signaling receptor comple
x adaptor activity
 NAS molecular function
GO:0042102 positive regulation of T
cell proliferation
 IMP biological process
GO:0005737 cytoplasm
 NAS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005102 signaling receptor bindin
g
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0030838 positive regulation of ac
tin filament polymerizati
on
 IMP biological process
GO:0008093 cytoskeletal anchor activ
ity
 NAS molecular function
GO:0007172 signal complex assembly
 NAS biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05130Pathogenic Escherichia coli infection
hsa04360Axon guidance
hsa04660T cell receptor signaling pathway
hsa04012ErbB signaling pathway

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
13 (5 controls,
8 cases)
 Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract