• Gene id: 4680

Gene Summary

• Gene Symbol: CEACAM6   Gene   UCSC   Ensembl
• Aliases: CD66c, CEAL, NCA
• Gene name: CEA cell adhesion molecule 6
• Alternate names: carcinoembryonic antigen-related cell adhesion molecule 6, Cluster of Differentiation 66c, carcinoembryonic antigen related cell adhesion molecule 6, carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen), normal cross,
• Gene location: 19q13.2 (41755528: 41772210)     Exons: 3     NC_000019.10
• Gene summary(Entrez): This gene encodes a protein that belongs to the carcinoembryonic antigen (CEA) family whose members are glycosyl phosphatidyl inositol (GPI) anchored cell surface glycoproteins. Members of this family play a role in cell adhesion and are widely used as tu
• OMIM: 163980

Protein Summary

• Protein general information: P40199  
  • Name: Carcinoembryonic antigen related cell adhesion molecule 6 (Non specific crossreacting antigen) (Normal cross reacting antigen) (CD antigen CD66c)
  • Length: 344  
  • Mass: 37195
  • Tissue specificity: Expressed in neutrophils (PubMed
• Sequence:

  MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDG
  NSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSIS
  SNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANR
  SDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQ
  AHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI

• Structural information:
  • Protein Domains: (35..14-)
    (/note="Ig-like-V-type)
    (/evidence="ECO:0000250|UniProtKB:P31997-)
    (145..23-)
    1 (/note="Ig-like-C2-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00114-)
    (240..31-)
    2 (/note="Ig-like-C2-type)
    (/evidence="ECO:0000255|PROSIT-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598   IPR013106  
  • Prosite: PS50835
  • PDB: 4WHC 4WTZ 4Y8A 4YIQ
  • PDBsum: 4WHC 4WTZ 4Y8A 4YIQ
  • STRING: ENSP00000199764
• Other Databases: GeneCards:  CEACAM6  Malacards:  CEACAM6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046982	protein heterodimerization activity	IDA	molecular function
GO:0042802	identical protein binding	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IC	cellular component
GO:0031225	anchored component of membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0007165	signal transduction	IMP	biological process
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	biological process
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	biological process
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:2000811	negative regulation of anoikis	IMP	biological process
GO:2000811	negative regulation of anoikis	IMP	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IMP	biological process
GO:1904906	positive regulation of endothelial cell-matrix adhesion via fibronectin	IMP	biological process
GO:0034116	positive regulation of heterotypic cell-cell adhesion	IMP	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881