• Gene id: 468

Gene Summary

• Gene Symbol: ATF4   Gene   UCSC   Ensembl
• Aliases: CREB-2, CREB2, TAXREB67, TXREB
• Gene name: activating transcription factor 4
• Alternate names: cyclic AMP-dependent transcription factor ATF-4, DNA-binding protein TAXREB67, cAMP response element-binding protein 2, cAMP-dependent transcription factor ATF-4, cAMP-responsive element-binding protein 2, cyclic AMP-responsive element-binding protein 2, tax-re,
• Gene location: 22q13.1 (39514493: 39522685)     Exons: 3     NC_000022.11
• Gene summary(Entrez): This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as
• OMIM: 604064

SNPs

rs3750075

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000007.14   g.73329400C>A
NC_000007.14   g.73329400C>T
NW_003871064.1   g.858636C>A
NW_003871064.1   g.858636C>T
NG_023242.2   g.6245C>A
NG_023242.2   g.6245C>T
NM_003602.5   c.216C>A
NM_003602.5   c.216C>T
NM_003602.4   c.216C>A
NM_003602.4   c.216C>T
NM_001135211.3  

rs3212293

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000024.10   g.13479612C>G
NC_000024.10   g.13479612C>T
NC_000024.9   g.15591492C>G
NC_000024.9   g.15591492C>T
NM_007125.4   c.54G>C
NM_007125.4   c.54G>A
XM_006724875.4   c.54G>C
XM_006724875.4   c.54G>A
XM_005262518.4   c.54G>C
XM_005262518.4   c.54G>A
XM_005262518  

Protein Summary

• Protein general information: P18848  
  • Name: Cyclic AMP dependent transcription factor ATF 4 (cAMP dependent transcription factor ATF 4) (Activating transcription factor 4) (Cyclic AMP responsive element binding protein 2) (CREB 2) (cAMP responsive element binding protein 2) (DNA binding protein TAX
  • Length: 351  
  • Mass: 38590
• Sequence:

  MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSK
  EDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTK
  PDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSP
  ESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKR
  AEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP

• Structural information:
  • Protein Domains: (278..34-)
    (/note="bZIP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00978"-)
  • Interpro: IPR029811  IPR004827  
  • Prosite: PS50217 PS00036
  • PDB: 1CI6
  • PDBsum: 1CI6
  • DIP: 354
  • STRING: ENSP00000336790
• Other Databases: GeneCards:  ATF4  Malacards:  ATF4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	contributes to
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0043522	leucine zipper domain binding	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	molecular function
GO:0036003	positive regulation of transcription from RNA polymerase II promoter in response to stress	IC	biological process
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:1990589	ATF4-CREB1 transcription factor complex	IDA	cellular component
GO:0000976	transcription regulatory region sequence-specific DNA binding	TAS	molecular function
GO:0001085	RNA polymerase II transcription factor binding	IPI	molecular function
GO:0034399	nuclear periphery	IDA	cellular component
GO:0043005	neuron projection	IDA	cellular component
GO:0036091	positive regulation of transcription from RNA polymerase II promoter in response to oxidative stress	IMP	biological process
GO:0036091	positive regulation of transcription from RNA polymerase II promoter in response to oxidative stress	ISS	biological process
GO:1990037	Lewy body core	IDA	cellular component
GO:1990590	ATF1-ATF4 transcription factor complex	IDA	cellular component
GO:1990617	CHOP-ATF4 complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:1903204	negative regulation of oxidative stress-induced neuron death	IGI	biological process
GO:0036499	PERK-mediated unfolded protein response	TAS	biological process
GO:0036499	PERK-mediated unfolded protein response	TAS	biological process
GO:0042149	cellular response to glucose starvation	IMP	biological process
GO:0061395	positive regulation of transcription from RNA polymerase II promoter in response to arsenic-containing substance	TAS	biological process
GO:1990440	positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IDA	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0034976	response to endoplasmic reticulum stress	IMP	biological process
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:1990617	CHOP-ATF4 complex	IPI	cellular component
GO:1990617	CHOP-ATF4 complex	NAS	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:1990440	positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IMP	biological process
GO:0010575	positive regulation of vascular endothelial growth factor production	IMP	biological process
GO:0045943	positive regulation of transcription by RNA polymerase I	IMP	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0036091	positive regulation of transcription from RNA polymerase II promoter in response to oxidative stress	IBA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:1990440	positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IBA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0003677	DNA binding	IDA	molecular function
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0070982	L-asparagine metabolic process	IDA	biological process
GO:0045667	regulation of osteoblast differentiation	IDA	biological process
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0031667	response to nutrient levels	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	ISS	biological process
GO:0070309	lens fiber cell morphogenesis	ISS	biological process
GO:0048167	regulation of synaptic plasticity	ISS	biological process
GO:0036499	PERK-mediated unfolded protein response	ISS	biological process
GO:0034599	cellular response to oxidative stress	ISS	biological process
GO:0030968	endoplasmic reticulum unfolded protein response	ISS	biological process
GO:0034198	cellular response to amino acid starvation	ISS	biological process
GO:0042789	mRNA transcription by RNA polymerase II	ISS	biological process
GO:0034198	cellular response to amino acid starvation	ISS	biological process
GO:0032057	negative regulation of translational initiation in response to stress	ISS	biological process
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0043525	positive regulation of neuron apoptotic process	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046982	protein heterodimerization activity	ISS	molecular function
GO:0008140	cAMP response element binding protein binding	ISS	molecular function
GO:0035162	embryonic hemopoiesis	ISS	biological process
GO:0030282	bone mineralization	ISS	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:0034644	cellular response to UV	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0036499	PERK-mediated unfolded protein response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000120	positive regulation of sodium-dependent phosphate transport	IEA	biological process
GO:1990589	ATF4-CREB1 transcription factor complex	IEA	cellular component
GO:0090575	RNA polymerase II transcription regulator complex	IEA	cellular component
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0042789	mRNA transcription by RNA polymerase II	IEA	biological process
GO:0036499	PERK-mediated unfolded protein response	IEA	biological process
GO:0034198	cellular response to amino acid starvation	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0006874	cellular calcium ion homeostasis	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0006094	gluconeogenesis	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:1903204	negative regulation of oxidative stress-induced neuron death	IEA	biological process
GO:0090650	cellular response to oxygen-glucose deprivation	IEA	biological process
GO:0036091	positive regulation of transcription from RNA polymerase II promoter in response to oxidative stress	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:1990590	ATF1-ATF4 transcription factor complex	IEA	cellular component
GO:1990440	positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IEA	biological process
GO:1905461	positive regulation of vascular associated smooth muscle cell apoptotic process	IEA	biological process
GO:0120163	negative regulation of cold-induced thermogenesis	IEA	biological process
GO:0070169	positive regulation of biomineral tissue development	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0043525	positive regulation of neuron apoptotic process	IEA	biological process
GO:0034976	response to endoplasmic reticulum stress	IEA	biological process
GO:0032922	circadian regulation of gene expression	IEA	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA	molecular function
GO:1990737	response to manganese-induced endoplasmic reticulum stress	IEA	biological process
GO:0043267	negative regulation of potassium ion transport	IEA	biological process
GO:0032590	dendrite membrane	IEA	cellular component
GO:0030182	neuron differentiation	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0007214	gamma-aminobutyric acid signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0034976	response to endoplasmic reticulum stress	IDA	biological process
GO:0016607	nuclear speck	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:1903351	cellular response to dopamine	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0005813	centrosome	IDA	colocalizes with
GO:0032991	protein-containing complex	IDA	cellular component
GO:0003677	DNA binding	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0006366	transcription by RNA polymerase II	ISS	biological process
GO:0006094	gluconeogenesis	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0006355	regulation of transcription, DNA-templated	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003677	DNA binding	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa05012	Parkinson disease
hsa05166	Human T-cell leukemia virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa05034	Alcoholism
hsa05203	Viral carcinogenesis
hsa04141	Protein processing in endoplasmic reticulum
hsa04022	cGMP-PKG signaling pathway
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04934	Cushing syndrome
hsa04932	Non-alcoholic fatty liver disease
hsa05161	Hepatitis B
hsa04728	Dopaminergic synapse
hsa04210	Apoptosis
hsa04926	Relaxin signaling pathway
hsa04722	Neurotrophin signaling pathway
hsa04725	Cholinergic synapse
hsa04935	Growth hormone synthesis, secretion and action
hsa04915	Estrogen signaling pathway
hsa04922	Glucagon signaling pathway
hsa04668	TNF signaling pathway
hsa04925	Aldosterone synthesis and secretion
hsa04928	Parathyroid hormone synthesis, secretion and action
hsa04912	GnRH signaling pathway
hsa04911	Insulin secretion
hsa04211	Longevity regulating pathway
hsa04137	Mitophagy - animal
hsa04918	Thyroid hormone synthesis
hsa05215	Prostate cancer
hsa04720	Long-term potentiation
hsa05031	Amphetamine addiction
hsa04927	Cortisol synthesis and secretion
hsa05030	Cocaine addiction

Diseases

Associated diseases	References
Prostate cancer	PMID:25680860
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)