• Gene id: 4678

Gene Summary

• Gene Symbol: NASP   Gene   UCSC   Ensembl
• Aliases: FLB7527, HMDRA1, PRO1999
• Gene name: nuclear autoantigenic sperm protein
• Alternate names: nuclear autoantigenic sperm protein, NASP histone chaperone, histone H1-binding protein, nuclear autoantigenic sperm protein (histone-binding),
• Gene location: 1p34.1 (45583987: 45618905)     Exons: 16     NC_000001.11
• Gene summary(Entrez): This gene encodes a H1 histone binding protein that is involved in transporting histones into the nucleus of dividing cells. Multiple isoforms are encoded by transcript variants of this gene. The somatic form is expressed in all mitotic cells, is localize
• OMIM: 603185

Protein Summary

• Protein general information: P49321  
  • Name: Nuclear autoantigenic sperm protein (NASP)
  • Length: 788  
  • Mass: 85238
  • Tissue specificity: Isoform 1 is testis- and sperm-specific.
• Sequence:

  MAMESTATAAVAAELVSADKIEDVPAPSTSADKVESLDVDSEAKKLLGLGQKHLVMGDIPAAVNAFQEAASLLGK
  KYGETANECGEAFFFYGKSLLELARMENGVLGNALEGVHVEEEEGEKTEDESLVENNDNIDEEAREELREQVYDA
  MGEKEEAKKTEDKSLAKPETDKEQDSEMEKGGREDMDISKSAEEPQEKVDLTLDWLTETSEEAKGGAAPEGPNEA
  EVTSGKPEQEVPDAEEEKSVSGTDVQEECREKGGQEKQGEVIVSIEEKPKEVSEEQPVVTLEKQGTAVEVEAESL
  DPTVKPVDVGGDEPEEKVVTSENEAGKAVLEQLVGQEVPPAEESPEVTTEAAEASAVEAGSEVSEKPGQEAPVLP
  KDGAVNGPSVVGDQTPIEPQTSIERLTETKDGSGLEEKVRAKLVPSQEETKLSVEESEAAGDGVDTKVAQGATEK
  SPEDKVQIAANEETQEREEQMKEGEETEGSEEDDKENDKTEEMPNDSVLENKSLQENEEEEIGNLELAWDMLDLA
  KIIFKRQETKEAQLYAAQAHLKLGEVSVESENYVQAVEEFQSCLNLQEQYLEAHDRLLAETHYQLGLAYGYNSQY
  DEAVAQFSKSIEVIENRMAVLNEQVKEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV
  ESSTSGFTPGGGGSSVSMIASRKPTDGASSSNCVTDISHLVRKKRKPEEESPRKDDAKKAKQEPEVNGGSGDAVP
  SGNEVSENMEEEAENQAESRAAVEGTVEAGATVESTAC

• Structural information:
  • Interpro: IPR019544  IPR013026  IPR011990  IPR019734  
  • Prosite: PS50005 PS50293
  • DIP: 47269
  • STRING: ENSP00000255120
• Other Databases: GeneCards:  NASP  Malacards:  NASP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0006335	DNA replication-dependent nucleosome assembly	IBA	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0034080	CENP-A containing nucleosome assembly	IBA	biological process
GO:0042393	histone binding	IBA	molecular function
GO:0042393	histone binding	IDA	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0033574	response to testosterone	IEA	biological process
GO:0008584	male gonad development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0006335	DNA replication-dependent nucleosome assembly	IDA	biological process
GO:0006336	DNA replication-independent nucleosome assembly	IDA	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0001824	blastocyst development	ISS	biological process
GO:0006335	DNA replication-dependent nucleosome assembly	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0000082	G1/S transition of mitotic cell cycle	ISS	biological process
GO:0043486	histone exchange	ISS	biological process

Diseases

Associated diseases	References
Ovarian cancer	PMID:20164540
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881