• Gene id: 4677

Gene Summary

• Gene Symbol: NARS1   Gene   UCSC   Ensembl
• Aliases: ASNRS, NARS
• Gene name: asparaginyl-tRNA synthetase 1
• Alternate names: asparagine--tRNA ligase, cytoplasmic, asparagine tRNA ligase 1, cytoplasmic, asparaginyl-tRNA synthetase, cytoplasmic,
• Gene location: 18q21.31 (57621835: 57600655)     Exons: 14     NC_000018.10
• Gene summary(Entrez): Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Asparaginyl-tRNA synthetase is localized to the cytoplasm and belongs to the class II family of tRNA synthetases. The N-terminal domain represents the s
• OMIM: 108410

SNPs

rs17855750

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000016.10   g.28503907A>C
NC_000016.10   g.28503907A>T
NC_000016.9   g.28515228A>C
NC_000016.9   g.28515228A>T
NM_145659.3   c.175T>G
NM_145659.3   c.175T>A
XM_011545780.2   c.181T>G
XM_011545780.2   c.181T>A
NP_663634.2   p.Ser59Ala
NP_663634.2   p.Ser59Thr
XP_01154  

rs153109

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000016.10   g.28507775T>C
NC_000016.9   g.28519096T>C|SEQ=[T/C]|GENE=IL27

Protein Summary

• Protein general information: O43776  
  • Name: Asparagine tRNA ligase, cytoplasmic (EC 6.1.1.22) (Asparaginyl tRNA synthetase) (AsnRS) (Asparaginyl tRNA synthetase 1)
  • Length: 548  
  • Mass: 62943
• Sequence:

  MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMWHREQM
  KSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLR
  DGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESD
  VDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSS
  QLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVH
  ELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQ
  RCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLT
  WILNRYHIRDVCLYPRFVQRCTP

• Structural information:
  • Interpro: IPR004364  IPR006195  IPR004522  IPR002312  IPR012340   IPR004365  
  • Prosite: PS50862
  • PDB: 4ZYA 5XIX
  • PDBsum: 4ZYA 5XIX
  • STRING: ENSP00000256854
• Other Databases: GeneCards:  NARS1  Malacards:  NARS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016477	cell migration	IDA	biological process
GO:0031728	CCR3 chemokine receptor binding	IDA	molecular function
GO:0006421	asparaginyl-tRNA aminoacylation	IDA	biological process
GO:0046983	protein dimerization activity	IDA	molecular function
GO:0004816	asparagine-tRNA ligase activity	IMP	molecular function
GO:0004812	aminoacyl-tRNA ligase activity	IEA	molecular function
GO:0004816	asparagine-tRNA ligase activity	IEA	molecular function
GO:0006418	tRNA aminoacylation for protein translation	IEA	biological process
GO:0006421	asparaginyl-tRNA aminoacylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004812	aminoacyl-tRNA ligase activity	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016874	ligase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004816	asparagine-tRNA ligase activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0004816	asparagine-tRNA ligase activity	IEA	molecular function
GO:0004816	asparagine-tRNA ligase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006418	tRNA aminoacylation for protein translation	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00970	Aminoacyl-tRNA biosynthesis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)