• Gene id: 4676

Gene Summary

• Gene Symbol: NAP1L4   Gene   UCSC   Ensembl
• Aliases: NAP1L4b, NAP2, NAP2L, hNAP2
• Gene name: nucleosome assembly protein 1 like 4
• Alternate names: nucleosome assembly protein 1-like 4, NAP-2, nucleosome assembly protein 1-like 4b, nucleosome assembly protein 2,
• Gene location: 11p15.4 (13586810: 13645343)     Exons: 12     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the nucleosome assembly protein (NAP) family which can interact with both core and linker histones. It can shuttle between the cytoplasm and nucleus, suggesting a role as a histone chaperone. This gene is one of several locat
• OMIM: 601651

Protein Summary

• Protein general information: Q99733  
  • Name: Nucleosome assembly protein 1 like 4 (Nucleosome assembly protein 2) (NAP 2)
  • Length: 375  
  • Mass: 42823
  • Tissue specificity: Ubiquitous. Biallelically expressed in fetal and adult tissues. Highest levels in testis. {ECO
• Sequence:

  MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINALKQLQV
  RCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESEWHSENEEEEKLAGDMKSKVVVTEKAAAT
  AEEPDPKGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKVKFSDPGQPMSFVLEFHFEPNDYFTNSVLTKTY
  KMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFNPLKASG
  DGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGEEGEEEELEGDEEGEDEDDAEINPKV

• Structural information:
  • Interpro: IPR037231  IPR002164  
  • STRING: ENSP00000369915
• Other Databases: GeneCards:  NAP1L4  Malacards:  NAP1L4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003682	chromatin binding	IBA	molecular function
GO:0006334	nucleosome assembly	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0042393	histone binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006334	nucleosome assembly	IDA	biological process
GO:0031491	nucleosome binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006334	nucleosome assembly	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0051082	unfolded protein binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray