• Gene id: 4675

Gene Summary

• Gene Symbol: NAP1L3   Gene   UCSC   Ensembl
• Aliases: MB20, NPL3
• Gene name: nucleosome assembly protein 1 like 3
• Alternate names: nucleosome assembly protein 1-like 3,
• Gene location: Xq21.32 (93673577: 93670929)     Exons: 8     NC_000023.11
• Gene summary(Entrez): This gene is intronless and encodes a member of the nucleosome assembly protein (NAP) family. This gene is linked closely to a region of genes responsible for several X-linked cognitive disability syndromes. [provided by RefSeq, Dec 2010]
• OMIM: 300117

Protein Summary

• Protein general information: Q99457  
  • Name: Nucleosome assembly protein 1 like 3
  • Length: 506  
  • Mass: 57593
• Sequence:

  MAEADFKMVSEPVAHGVAEEEMASSTSDSGEESDSSSSSSSTSDSSSSSSTSGSSSGSGSSSSSSGSTSSRSRLY
  RKKRVPEPSRRARRAPLGTNFVDRLPQAVRNRVQALRNIQDECDKVDTLFLKAIHDLERKYAELNKPLYDRRFQI
  INAEYEPTEEECEWNSEDEEFSSDEEVQDNTPSEMPPLEGEEEENPKENPEVKAEEKEVPKEIPEVKDEEKEVPK
  EIPEVKAEEKADSKDCMEATPEVKEDPKEVPQVKADDKEQPKATEAKARAAVRETHKRVPEERLQDSVDLKRARK
  GKPKREDPKGIPDYWLIVLKNVDKLGPMIQKYDEPILKFLSDVSLKFSKPGQPVSYTFEFHFLPNPYFRNEVLVK
  TYIIKAKPDHNDPFFSWGWEIEDCKGCKIDWRRGKDVTVTTTQSRTTATGEIEIQPRVVPNASFFNFFSPPEIPM
  IGKLEPREDAILDEDFEIGQILHDNVILKSIYYYTGEVNGTYYQFGKHYGNKKYRK

• Structural information:
  • Interpro: IPR037231  IPR002164  
  • STRING: ENSP00000362171
• Other Databases: GeneCards:  NAP1L3  Malacards:  NAP1L3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0003682	chromatin binding	IBA	molecular function
GO:0006334	nucleosome assembly	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0042393	histone binding	IBA	molecular function
GO:0006334	nucleosome assembly	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006334	nucleosome assembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)