• Gene id: 4674

Gene Summary

• Gene Symbol: NAP1L2   Gene   UCSC   Ensembl
• Aliases: BPX
• Gene name: nucleosome assembly protein 1 like 2
• Alternate names: nucleosome assembly protein 1-like 2, brain specific gene BPX, brain-specific protein, X-linked,
• Gene location: Xq13.2 (73214850: 73212298)     Exons: 1     NC_000023.11
• Gene summary(Entrez): The protein encoded by this intronless gene is a member of the nucleosome assembly protein (NAP) family. The encoded protein represents a class of tissue-specific factors that interact with chromatin to regulate neuronal cell proliferation. [provided by R
• OMIM: 600157

Protein Summary

• Protein general information: Q9ULW6  
  • Name: Nucleosome assembly protein 1 like 2 (Brain specific protein, X linked)
  • Length: 460  
  • Mass: 52542
• Sequence:

  MAESENRKELSESSQEEAGNQIMVEGLGEHLERGEDAAAGLGDDGKCGEEAAAGLGEEGENGEDTAAGSGEDGKK
  GGDTDEDSEADRPKGLIGYVLDTDFVESLPVKVKYRVLALKKLQTRAANLESKFLREFHDIERKFAEMYQPLLEK
  RRQIINAIYEPTEEECEYKSDSEDCDDEEMCHEEMYGNEEGMVHEYVDEDDGYEDYYYDYAVEEEEEEEEEDDIE
  ATGEENKEEEDPKGIPDFWLTVLKNVDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNE
  LLTKTYVLKSKLAYYDPHPYRGTAIEYSTGCEIDWNEGKNVTLKTIKKKQKHRIWGTIRTVTEDFPKDSFFNFFS
  PHGITSNGRDGNDDFLLGHNLRTYIIPRSVLFFSGDALESQQEGVVREVNDAIYDKIIYDNWMAAIEEVKACCKN
  LEALVEDIDR

• Structural information:
  • Interpro: IPR037231  IPR002164  
  • STRING: ENSP00000362616
• Other Databases: GeneCards:  NAP1L2  Malacards:  NAP1L2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003682	chromatin binding	IBA	molecular function
GO:0006334	nucleosome assembly	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0042393	histone binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006334	nucleosome assembly	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0006334	nucleosome assembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071442	positive regulation of histone H3-K14 acetylation	IEA	biological process
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0042393	histone binding	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:2000617	positive regulation of histone H3-K9 acetylation	IEA	biological process
GO:2000035	regulation of stem cell division	IEA	biological process
GO:0035066	positive regulation of histone acetylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003682	chromatin binding	IBA	molecular function
GO:0006334	nucleosome assembly	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0042393	histone binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006334	nucleosome assembly	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0006334	nucleosome assembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071442	positive regulation of histone H3-K14 acetylation	IEA	biological process
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0042393	histone binding	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:2000617	positive regulation of histone H3-K9 acetylation	IEA	biological process
GO:2000035	regulation of stem cell division	IEA	biological process
GO:0035066	positive regulation of histone acetylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881