• Gene id: 467

Gene Summary

• Gene Symbol: ATF3   Gene   UCSC   Ensembl
• Gene name: activating transcription factor 3
• Alternate names: cyclic AMP-dependent transcription factor ATF-3, cAMP-dependent transcription factor ATF-3,
• Gene location: 1q32.3 (212565333: 212620776)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. This gene is induced by a variety of signals, including many of those encountered by cancer cells,
• OMIM: 603148

SNPs

rs17855750

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000016.10   g.28503907A>C
NC_000016.10   g.28503907A>T
NC_000016.9   g.28515228A>C
NC_000016.9   g.28515228A>T
NM_145659.3   c.175T>G
NM_145659.3   c.175T>A
XM_011545780.2   c.181T>G
XM_011545780.2   c.181T>A
NP_663634.2   p.Ser59Ala
NP_663634.2   p.Ser59Thr
XP_01154  

rs153109

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000016.10   g.28507775T>C
NC_000016.9   g.28519096T>C|SEQ=[T/C]|GENE=IL27

rs11119982

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000001.11   g.212591502C>T
NC_000001.10   g.212764844C>T
NG_029871.1   g.31148C>T|SEQ=[C/T]|GENE=ATF3

rs10475

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000001.11   g.212620271T>C
NC_000001.10   g.212793613T>C
NG_029871.1   g.59917T>C
NM_001674.4   c.*716T>C
NM_001674.3   c.*716T>C
NM_001040619.3   c.*1166T>C
NM_001040619.2   c.*1166T>C
NM_001030287.3   c.*716T>C
NM_001206488.3   c.*716T>C
NM_001206488.2   c.*716T>C
  

Protein Summary

• Protein general information: P18847  
  • Name: Cyclic AMP dependent transcription factor ATF 3 (cAMP dependent transcription factor ATF 3) (Activating transcription factor 3)
  • Length: 181  
  • Mass: 20,576
  • Tissue specificity: Highest expression in the placenta; moderate level in liver, lung, kidney, and pancreas. LIMK2a is found to be more abundant then LIMK2b in liver, colon, stomach, and spleen, while in brain, kidney, and placenta LIMK2b is the dominant
• Sequence:

  MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVS
  ITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHR
  PTCIVRAQNGRTPEDERNLFIQQIKEGTLQS

• Structural information:
  • Protein Domains: bZIP. (86-149)
  • Interpro: IPR000837  IPR029812  IPR004827  
  • Prosite: PS50217 PS00036
  • DIP: 344
  • STRING: ENSP00000344352
• Other Databases: GeneCards:  ATF3  Malacards:  ATF3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000977	RNA polymerase II regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	IBA	molecular function
GO:0000982	transcription factor activity, RNA polymerase II core promoter proximal region sequence-specific binding	IBA	molecular function
GO:0001078	transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding	IEA	molecular function
GO:0001228	transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding	IC	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IGI	molecular function
GO:0003714	transcription corepressor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0006094	gluconeogenesis	IEA	biological process
GO:0006366	transcription from RNA polymerase II promoter	IEA	biological process
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0034198	cellular response to amino acid starvation	IEA	biological process
GO:0035914	skeletal muscle cell differentiation	IEA	biological process
GO:0036499	PERK-mediated unfolded protein response	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0061394	regulation of transcription from RNA polymerase II promoter in response to arsenic-containing substance	TAS	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:1903984	positive regulation of TRAIL-activated apoptotic signaling pathway	IMP	biological process
GO:1990440	positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IDA	biological process
GO:1990622	CHOP-ATF3 complex	IDA	cellular component
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000977	RNA polymerase II regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	IEA	molecular function
GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	IBA	molecular function
GO:0000982	transcription factor activity, RNA polymerase II core promoter proximal region sequence-specific binding	IBA	molecular function
GO:0001078	transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding	IEA	molecular function
GO:0001228	transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding	IC	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IGI	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	TAS	molecular function
GO:0003714	transcription corepressor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0006094	gluconeogenesis	IEA	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006357	regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0006366	transcription from RNA polymerase II promoter	IEA	biological process
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0030968	endoplasmic reticulum unfolded protein response	IEA	biological process
GO:0034198	cellular response to amino acid starvation	IEA	biological process
GO:0035914	skeletal muscle cell differentiation	IEA	biological process
GO:0036499	PERK-mediated unfolded protein response	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0061394	regulation of transcription from RNA polymerase II promoter in response to arsenic-containing substance	TAS	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:1903984	positive regulation of TRAIL-activated apoptotic signaling pathway	IMP	biological process
GO:1990440	positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IDA	biological process
GO:1990622	CHOP-ATF3 complex	IDA	cellular component
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000977	RNA polymerase II regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	IBA	molecular function
GO:0000982	transcription factor activity, RNA polymerase II core promoter proximal region sequence-specific binding	IBA	molecular function
GO:0001228	transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding	IC	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IGI	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	TAS	molecular function
GO:0003714	transcription corepressor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0036499	PERK-mediated unfolded protein response	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0061394	regulation of transcription from RNA polymerase II promoter in response to arsenic-containing substance	TAS	biological process
GO:1903984	positive regulation of TRAIL-activated apoptotic signaling pathway	IMP	biological process
GO:1990440	positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IDA	biological process
GO:1990622	CHOP-ATF3 complex	IDA	cellular component

Diseases

Associated diseases	References
Chronic renal failure	GAD: 21085059
Hypospadias	GAD: 18426833
Cryptorchidism	MIK: 20215396
Hypospadias	MIK: 17437852
Hypospadias	MIK: 20215396
Hypospadias	MIK: 20733963
Hypospadias	MIK: 24778562
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20215396	Hypospadias	SRD5A2 (rs523349), ESR1 (rs6932902), ESR2 (rs2987983), ATF3 (rs11119982)	Caucasi an	1216 (620 Caucasian hypospadias cases and 596 controls)	Male infertility	SRD5A2  ESR1 ESR2 ATF3
17437852	Hypospadias			2 (1 case, 1 control)	Male infertility
20733963	Hypospadias			20 cases	Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray
24778562	Hypospadias			13 (5 controls, 8 cases)	Male infertility	Microarray