• Gene id: 466

Gene Summary

• Gene Symbol: ATF1   Gene   UCSC   Ensembl
• Aliases: EWS-ATF1, FUS/ATF-1, TREB36
• Gene name: activating transcription factor 1
• Alternate names: cyclic AMP-dependent transcription factor ATF-1, cAMP-dependent transcription factor ATF-1,
• Gene location: 12q13.12 (50763681: 50821161)     Exons: 13     NC_000012.12
• Gene summary(Entrez): This gene encodes an activating transcription factor, which belongs to the ATF subfamily and bZIP (basic-region leucine zipper) family. It influences cellular physiologic processes by regulating the expression of downstream target genes, which are related
• OMIM: 123803

SNPs

rs10269148

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000007.14   g.135230056C>A
NC_000007.14   g.135230056C>G
NC_000007.13   g.134914808C>A
NC_000007.13   g.134914808C>G|SEQ=[C/A/G]|GENE=STRA8

rs17168319

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000007.14   g.135230201A>G
NC_000007.13   g.134914953A>G|SEQ=[A/G]|GENE=STRA8

rs17168337

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000007.14   g.135258880C>G
NC_000007.13   g.134943632C>G|SEQ=[C/G]|GENE=STRA8

Protein Summary

• Protein general information: P18846  
  • Name: Cyclic AMP dependent transcription factor ATF 1 (cAMP dependent transcription factor ATF 1) (Activating transcription factor 1) (Protein TREB36)
  • Length: 271  
  • Mass: 29233
• Sequence:

  MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILARRPSYRKILKDLSSED
  TRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQ
  YAQTSDGQQILVPSNQVVVQTASGDMQTYQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNRE
  AARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYSNKSV

• Structural information:
  • Protein Domains: (31..9-)
    (/note="KID-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00312-)
    (213..27-)
    (/note="bZIP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00978"-)
  • Interpro: IPR029825  IPR004827  IPR003102  IPR001630  
  • Prosite: PS50217 PS00036 PS50953
  • DIP: 652
  • STRING: ENSP00000262053
• Other Databases: GeneCards:  ATF1  Malacards:  ATF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0032025	response to cobalt ion	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005667	transcription regulator complex	IEA	cellular component
GO:1990590	ATF1-ATF4 transcription factor complex	IEA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0034622	cellular protein-containing complex assembly	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0045740	positive regulation of DNA replication	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:1990590	ATF1-ATF4 transcription factor complex	IDA	cellular component
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05202	Transcriptional misregulation in cancer
hsa04925	Aldosterone synthesis and secretion

Diseases

Associated diseases	References
Clear cell sarcoma of soft tissue	KEGG:H00052
Clear cell sarcoma of soft tissue	KEGG:H00052
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)