• Gene id: 4656

Gene Summary

• Gene Symbol: MYOG   Gene   UCSC   Ensembl
• Aliases: MYF4, bHLHc3, myf-4
• Gene name: myogenin
• Alternate names: myogenin, class C basic helix-loop-helix protein 3, myogenic factor 4,
• Gene location: 1q32.1 (203086011: 203083128)     Exons: 3     NC_000001.11
• Gene summary(Entrez): Myogenin is a muscle-specific transcription factor that can induce myogenesis in a variety of cell types in tissue culture. It is a member of a large family of proteins related by sequence homology, the helix-loop-helix (HLH) proteins. It is essential for

Protein Summary

• Protein general information: P15173  
  • Name: Myogenin (Class C basic helix loop helix protein 3) (bHLHc3) (Myogenic factor 4) (Myf 4)
  • Length: 224  
  • Mass: 25037
• Sequence:

  MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKR
  KSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRG
  GGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN

• Structural information:
  • Protein Domains: (81..13-)
    (/note="bHLH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00981"-)
  • Interpro: IPR002546  IPR011598  IPR036638  IPR039704  
  • Prosite: PS50888
  • CDD: cd00083
  • DIP: 159
  • STRING: ENSP00000241651
• Other Databases: GeneCards:  MYOG  Malacards:  MYOG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0048743	positive regulation of skeletal muscle fiber development	IBA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0035914	skeletal muscle cell differentiation	IBA	biological process
GO:0045663	positive regulation of myoblast differentiation	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:1901741	positive regulation of myoblast fusion	IBA	biological process
GO:0071392	cellular response to estradiol stimulus	ISS	biological process
GO:0048743	positive regulation of skeletal muscle fiber development	ISS	biological process
GO:0032993	protein-DNA complex	ISS	cellular component
GO:0014894	response to denervation involved in regulation of muscle adaptation	ISS	biological process
GO:0008285	negative regulation of cell population proliferation	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	ISS	molecular function
GO:1901739	regulation of myoblast fusion	ISS	biological process
GO:0071158	positive regulation of cell cycle arrest	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0045663	positive regulation of myoblast differentiation	ISS	biological process
GO:0031490	chromatin DNA binding	ISS	molecular function
GO:0014891	striated muscle atrophy	ISS	biological process
GO:0014878	response to electrical stimulus involved in regulation of muscle adaptation	ISS	biological process
GO:0014873	response to muscle activity involved in regulation of muscle adaptation	ISS	biological process
GO:0014842	regulation of skeletal muscle satellite cell proliferation	ISS	biological process
GO:0014737	positive regulation of muscle atrophy	ISS	biological process
GO:0010831	positive regulation of myotube differentiation	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0070888	E-box binding	ISS	molecular function
GO:0007517	muscle organ development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0007517	muscle organ development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0007519	skeletal muscle tissue development	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0051149	positive regulation of muscle cell differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071392	cellular response to estradiol stimulus	IEA	biological process
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0071356	cellular response to tumor necrosis factor	IEA	biological process
GO:0071285	cellular response to lithium ion	IEA	biological process
GO:0048743	positive regulation of skeletal muscle fiber development	IEA	biological process
GO:0048741	skeletal muscle fiber development	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0014902	myotube differentiation	IEA	biological process
GO:0014894	response to denervation involved in regulation of muscle adaptation	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0007517	muscle organ development	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0001503	ossification	IEA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0071259	cellular response to magnetism	IEA	biological process
GO:0045445	myoblast differentiation	IEA	biological process
GO:0043403	skeletal muscle tissue regeneration	IEA	biological process
GO:0032993	protein-DNA complex	IEA	cellular component
GO:0014902	myotube differentiation	IEA	biological process
GO:0014850	response to muscle activity	IEA	biological process
GO:0014732	skeletal muscle atrophy	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:1901739	regulation of myoblast fusion	IEA	biological process
GO:0071158	positive regulation of cell cycle arrest	IEA	biological process
GO:0070888	E-box binding	IEA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045663	positive regulation of myoblast differentiation	IEA	biological process
GO:0031490	chromatin DNA binding	IEA	molecular function
GO:0014891	striated muscle atrophy	IEA	biological process
GO:0014842	regulation of skeletal muscle satellite cell proliferation	IEA	biological process
GO:0014737	positive regulation of muscle atrophy	IEA	biological process
GO:0010831	positive regulation of myotube differentiation	IEA	biological process
GO:0007519	skeletal muscle tissue development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000987	cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:1903862	positive regulation of oxidative phosphorylation	IEA	biological process
GO:0071300	cellular response to retinoic acid	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045820	negative regulation of glycolytic process	IEA	biological process
GO:0014878	response to electrical stimulus involved in regulation of muscle adaptation	IEA	biological process
GO:0014873	response to muscle activity involved in regulation of muscle adaptation	IEA	biological process
GO:0009629	response to gravity	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	TAS	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0070888	E-box binding	ISS	molecular function
GO:0070888	E-box binding	ISS	molecular function
GO:0042693	muscle cell fate commitment	ISS	biological process
GO:0005667	transcription regulator complex	ISS	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	TAS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq