• Gene id: 4650

Gene Summary

• Gene Symbol: MYO9B   Gene   UCSC   Ensembl
• Aliases: CELIAC4, MYR5
• Gene name: myosin IXB
• Alternate names: unconventional myosin-IXb, myosin-IXb, unconventional myosin-9b,
• Gene location: 19p13.11 (17075776: 17213285)     Exons: 40     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the myosin family of actin-based molecular motor heavy chain proteins. The protein represents an unconventional myosin; it should not be confused with the conventional non-muscle myosin-9 (MYH9). The protein has four IQ motif
• OMIM: 603847

Protein Summary

• Protein general information: Q13459  
  • Name: Unconventional myosin IXb (Unconventional myosin 9b)
  • Length: 2157  
  • Mass: 243401
  • Tissue specificity: Detected in peripheral blood leukocytes (at protein level) (PubMed
• Sequence:

  MSVKEAGSSGRREQAAYHLHIYPQLSTTESQASCRVTATKDSTTSDVIKDAIASLRLDGTKCYVLVEVKESGGEE
  WVLDANDSPVHRVLLWPRRAQDEHPQEDGYYFLLQERNADGTIKYVHMQLVAQATATRRLVERGLLPRQQADFDD
  LCNLPELTEGNLLKNLKHRFLQQKIYTYAGSILVAINPFKFLPIYNPKYVKMYENQQLGKLEPHVFALADVAYYT
  MLRKRVNQCIVISGESGSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFI
  QVSYLESGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVSEEERQEFQLKQPEDYFYLNQHNLKIEDGE
  DLKHDFERLKQAMEMVGFLPATKKQIFAVLSAILYLGNVTYKKRATGREEGLEVGPPEVLDTLSQLLKVKREILV
  EVLTKRKTVTVNDKLILPYSLSEAITARDSMAKSLYSALFDWIVLRINHALLNKKDVEEAVSCLSIGVLDIFGFE
  DFERNSFEQFCINYANEQLQYYFNQHIFKLEQEEYQGEGITWHNIGYTDNVGCIHLISKKPTGLFYLLDEESNFP
  HATSQTLLAKFKQQHEDNKYFLGTPVMEPAFIIQHFAGKVKYQIKDFREKNMDYMRPDIVALLRGSDSSYVRELI
  GMDPVAVFRWAVLRAAIRAMAVLREAGRLRAERAEKAAGMSSPGAQSHPEELPRGASTPSEKLYRDLHNQMIKSI
  KGLPWQGEDPRSLLQSLSRLQKPRAFILKSKGIKQKQIIPKNLLDSKSLKLIISMTLHDRTTKSLLHLHKKKKPP
  SISAQFQTSLNKLLEALGKAEPFFIRCIRSNAEKKELCFDDELVLQQLRYTGMLETVRIRRSGYSAKYTFQDFTE
  QFQVLLPKDAQPCREVISTLLEKMKIDKRNYQIGKTKVFLKETERQALQETLHREVVRKILLLQSWFRMVLERRH
  FLQMKRAAVTIQACWRSYRVRRALERTQAAVYLQASWRGYWQRKLYRHQKQSIIRLQSLCRGHLQRKSFSQMISE
  KQKAEEKEREALEAARAGAEEGGQGQAAGGQQVAEQGPEPAEDGGHLASEPEVQPSDRSPLEHSSPEKEAPSPEK
  TLPPQKTVAAESHEKVPSSREKRESRRQRGLEHVKFQNKHIQSCKEESALREPSRRVTQEQGVSLLEDKKESRED
  ETLLVVETEAENTSQKQPTEQPQAMAVGKVSEETEKTLPSGSPRPGQLERPTSLALDSRVSPPAPGSAPETPEDK
  SKPCGSPRVQEKPDSPGGSTQIQRYLDAERLASAVELWRGKKLVAAASPSAMLSQSLDLSDRHRATGAALTPTEE
  RRTSFSTSDVSKLLPSLAKAQPAAETTDGERSAKKPAVQKKKPGDASSLPDAGLSPGSQVDSKSTFKRLFLHKTK
  DKKYSLEGAEELENAVSGHVVLEATTMKKGLEAPSGQQHRHAAGEKRTKEPGGKGKKNRNVKIGKITVSEKWRES
  VFRQITNANELKYLDEFLLNKINDLRSQKTPIESLFIEATEKFRSNIKTMYSVPNGKIHVGYKDLMENYQIVVSN
  LATERGQKDTNLVLNLFQSLLDEFTRGYTKNDFEPVKQSKAQKKKRKQERAVQEHNGHVFASYQVSIPQSCEQCL
  SYIWLMDKALLCSVCKMTCHKKCVHKIQSHCSYTYGRKGEPGVEPGHFGVCVDSLTSDKASVPIVLEKLLEHVEM
  HGLYTEGLYRKSGAANRTRELRQALQTDPAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPEK
  QEQLAAIYAVLEHLPEANHNSLERLIFHLVKVALLEDVNRMSPGALAIIFAPCLLRCPDNSDPLTSMKDVLKITT
  CVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPLKLGFSSPYEGVLNKSPKTRDIQEEELEVLL
  EEEAAGGDEDREKEILIERIQSIKEEKEDITYRLPELDPRGSDEENLDSETSASTESLLEERAGRGASEGPPAPA
  LPCPGAPTPSPLPTVAAPPRRRPSSFVTVRVKTPRRTPIMPTANIKLPPGLPSHLPRWAPGAREAAAPVRRREPP
  ARRPDQIHSVYITPGADLPVQGALEPLEEDGQPPGAKRRYSDPPTYCLPPASGQTNG

• Structural information:
  • Protein Domains: (15..11-)
    (/note="Ras-associating-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00166-)
    (146..95-)
    (/note="Myosin-motor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00782-)
    (957..97-)
    (/note="IQ-1)
    (/evidence="ECO:0000255|PROSITE-ProRule-)
  • Interpro: IPR000048  IPR036961  IPR028557  IPR001609  IPR036023   IPR027417  IPR002219  IPR000159  IPR008936  IPR000198  IPR029071  
  • Prosite: PS50096 PS51456 PS50200 PS50238 PS00479 PS50081
  • CDD: cd00029 cd01385
  • PDB: 5C5S 5HPY
  • PDBsum: 5C5S 5HPY
  • STRING: ENSP00000471457
• Other Databases: GeneCards:  MYO9B  Malacards:  MYO9B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005884	actin filament	IDA	cellular component
GO:0005884	actin filament	IDA	cellular component
GO:0005884	actin filament	IDA	cellular component
GO:0030048	actin filament-based movement	IDA	biological process
GO:0035385	Roundabout signaling pathway	IDA	biological process
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0017048	Rho GTPase binding	IPI	molecular function
GO:0048495	Roundabout binding	IPI	molecular function
GO:0035023	regulation of Rho protein signal transduction	IMP	biological process
GO:0000146	microfilament motor activity	IEA	molecular function
GO:0003774	motor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0007266	Rho protein signal transduction	IEA	biological process
GO:0030048	actin filament-based movement	IEA	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016459	myosin complex	IEA	cellular component
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016459	myosin complex	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0015629	actin cytoskeleton	TAS	cellular component
GO:0005096	GTPase activator activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005516	calmodulin binding	IDA	molecular function
GO:0003779	actin binding	IDA	molecular function
GO:0003779	actin binding	IDA	molecular function
GO:0000146	microfilament motor activity	IDA	molecular function
GO:0043531	ADP binding	IDA	molecular function
GO:0032011	ARF protein signal transduction	IDA	NOT|biological process
GO:0042803	protein homodimerization activity	IDA	NOT|molecular function
GO:0007266	Rho protein signal transduction	IC	biological process
GO:0005938	cell cortex	IDA	cellular component
GO:0005516	calmodulin binding	IDA	molecular function
GO:0003779	actin binding	IDA	molecular function
GO:0000146	microfilament motor activity	IDA	molecular function
GO:0000146	microfilament motor activity	IDA	molecular function
GO:0016887	ATPase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005524	ATP binding	IDA	molecular function
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030048	actin filament-based movement	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Celiac disease	KEGG:H02123
Celiac disease	KEGG:H02123
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray