• Gene id: 4641

Gene Summary

• Gene Symbol: MYO1C   Gene   UCSC   Ensembl
• Aliases: MMI-beta, MMIb, NMI, myr2
• Gene name: myosin IC
• Alternate names: unconventional myosin-Ic, myosin-I beta, myosin-Ic, nuclear myosin I,
• Gene location: 17p13.3 (1492685: 1464185)     Exons: 37     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the unconventional myosin protein family, which are actin-based molecular motors. The protein is found in the cytoplasm, and one isoform with a unique N-terminus is also found in the nucleus. The nuclear isoform associates wi
• OMIM: 171860

Protein Summary

• Protein general information: O00159  
  • Name: Unconventional myosin Ic (Myosin I beta) (MMI beta) (MMIb)
  • Length: 1063  
  • Mass: 121682
• Sequence:

  MALQVELVPTGEIIRVVHPHRPCKLALGSDGVRVTMESALTARDRVGVQDFVLLENFTSEAAFIENLRRRFRENL
  IYTYIGPVLVSVNPYRDLQIYSRQHMERYRGVSFYEVPPHLFAVADTVYRALRTERRDQAVMISGESGAGKTEAT
  KRLLQFYAETCPAPERGGAVRDRLLQSNPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKS
  RVVHQNHGERNFHIFYQLLEGGEEETLRRLGLERNPQSYLYLVKGQCAKVSSINDKSDWKVVRKALTVIDFTEDE
  VEDLLSIVASVLHLGNIHFAANEESNAQVTTENQLKYLTRLLSVEGSTLREALTHRKIIAKGEELLSPLNLEQAA
  YARDALAKAVYSRTFTWLVGKINRSLASKDVESPSWRSTTVLGLLDIYGFEVFQHNSFEQFCINYCNEKLQQLFI
  ELTLKSEQEEYEAEGIAWEPVQYFNNKIICDLVEEKFKGIISILDEECLRPGEATDLTFLEKLEDTVKHHPHFLT
  HKLADQRTRKSLGRGEFRLLHYAGEVTYSVTGFLDKNNDLLFRNLKETMCSSKNPIMSQCFDRSELSDKKRPETV
  ATQFKMSLLQLVEILQSKEPAYVRCIKPNDAKQPGRFDEVLIRHQVKYLGLLENLRVRRAGFAYRRKYEAFLQRY
  KSLCPETWPTWAGRPQDGVAVLVRHLGYKPEEYKMGRTKIFIRFPKTLFATEDALEVRRQSLATKIQAAWRGFHW
  RQKFLRVKRSAICIQSWWRGTLGRRKAAKRKWAAQTIRRLIRGFVLRHAPRCPENAFFLDHVRTSFLLNLRRQLP
  QNVLDTSWPTPPPALREASELLRELCIKNMVWKYCRSISPEWKQQLQQKAVASEIFKGKKDNYPQSVPRLFISTR
  LGTDEISPRVLQALGSEPIQYAVPVVKYDRKGYKPRSRQLLLTPNAVVIVEDAKVKQRIDYANLTGISVSSLSDS
  LFVLHVQRADNKQKGDVVLQSDHVIETLTKTALSANRVNSININQGSITFAGGPGRDGTIDFTPGSELLITKAKN
  GHLAVVAPRLNSR

• Structural information:
  • Protein Domains: (47..73-)
    (/note="Myosin-motor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00782-)
    (734..75-)
    (/note="IQ-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00116-)
    (758..78-)
    (/note="IQ-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00116";-)
  • Interpro: IPR000048  IPR036961  IPR001609  IPR010926  IPR036072   IPR027417  
  • Prosite: PS50096 PS51456 PS51757
  • CDD: cd01378
  • PDB: 4BYF
  • PDBsum: 4BYF
  • DIP: 33109
  • STRING: ENSP00000352834
• Other Databases: GeneCards:  MYO1C  Malacards:  MYO1C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051015	actin filament binding	IBA	molecular function
GO:0030050	vesicle transport along actin filament	IBA	biological process
GO:0015629	actin cytoskeleton	IBA	cellular component
GO:0007015	actin filament organization	IBA	biological process
GO:0005902	microvillus	IBA	cellular component
GO:0000146	microfilament motor activity	IBA	molecular function
GO:0031982	vesicle	IBA	cellular component
GO:0030898	actin-dependent ATPase activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0003774	motor activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016459	myosin complex	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0051028	mRNA transport	IEA	biological process
GO:0005643	nuclear pore	IEA	cellular component
GO:0005516	calmodulin binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0016459	myosin complex	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0045815	positive regulation of gene expression, epigenetic	TAS	biological process
GO:0051015	actin filament binding	IEA	molecular function
GO:0045121	membrane raft	IEA	cellular component
GO:0032587	ruffle membrane	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005516	calmodulin binding	IEA	molecular function
GO:0000146	microfilament motor activity	IEA	molecular function
GO:0071346	cellular response to interferon-gamma	IEA	biological process
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0030050	vesicle transport along actin filament	IEA	biological process
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:1900078	positive regulation of cellular response to insulin stimulus	IEA	biological process
GO:0032421	stereocilium bundle	IEA	cellular component
GO:0030898	actin-dependent ATPase activity	IEA	molecular function
GO:0030838	positive regulation of actin filament polymerization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:1900078	positive regulation of cellular response to insulin stimulus	IEA	biological process
GO:0090314	positive regulation of protein targeting to membrane	IEA	biological process
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0032420	stereocilium	IEA	cellular component
GO:0005903	brush border	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0005643	nuclear pore	IEA	cellular component
GO:0060171	stereocilium membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0006612	protein targeting to membrane	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0006605	protein targeting	IDA	biological process
GO:0016328	lateral plasma membrane	IDA	cellular component
GO:0006605	protein targeting	IDA	biological process
GO:0005902	microvillus	IDA	cellular component
GO:0031941	filamentous actin	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0009925	basal plasma membrane	IDA	cellular component
GO:0001725	stress fiber	IDA	NOT|cellular component
GO:2000810	regulation of bicellular tight junction assembly	IMP	biological process
GO:0038089	positive regulation of cell migration by vascular endothelial growth factor signaling pathway	IMP	biological process
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:1900748	positive regulation of vascular endothelial growth factor signaling pathway	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0016020	membrane	HDA	cellular component
GO:0090314	positive regulation of protein targeting to membrane	IMP	biological process
GO:0016461	unconventional myosin complex	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0017160	Ral GTPase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05130	Pathogenic Escherichia coli infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq