• Gene id: 4635

Gene Summary

• Gene Symbol: MYL4   Gene   UCSC   Ensembl
• Aliases: ALC1, AMLC, GT1, PRO1957
• Gene name: myosin light chain 4
• Alternate names: myosin light chain 4, atrial myosin light chain 1, myosin light chain 1, embryonic muscle/atrial isoform, myosin light chain alkali GT-1 isoform, myosin, atrial/fetal muscle, light chain, myosin, light chain 4, alkali; atrial, embryonic, myosin, light polypepti,
• Gene location: 17q21.32 (36547478: 36493888)     Exons: 15     NC_000006.12
• Gene summary(Entrez): Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that
• OMIM: 160770

Protein Summary

• Protein general information: P12829  
  • Name: Myosin light chain 4 (Myosin light chain 1, embryonic muscle/atrial isoform) (Myosin light chain alkali GT 1 isoform)
  • Length: 197  
  • Mass: 21565
• Sequence:

  MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITY
  GQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTV
  MGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG

• Structural information:
  • Protein Domains: (51..8-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (130..16-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448"-)
  • Interpro: IPR011992  IPR002048  
  • Prosite: PS50222
  • CDD: cd00051
  • STRING: ENSP00000347055
• Other Databases: GeneCards:  MYL4  Malacards:  MYL4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IEA	molecular function
GO:0016459	myosin complex	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030049	muscle filament sliding	TAS	biological process
GO:0003785	actin monomer binding	IDA	molecular function
GO:0032038	myosin II heavy chain binding	NAS	molecular function
GO:0051015	actin filament binding	IMP	molecular function
GO:0002026	regulation of the force of heart contraction	IMP	biological process
GO:0031672	A band	IMP	cellular component
GO:0032781	positive regulation of ATPase activity	IMP	biological process
GO:0060048	cardiac muscle contraction	IMP	biological process
GO:0060048	cardiac muscle contraction	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04371	Apelin signaling pathway
hsa04260	Cardiac muscle contraction

Diseases

Associated diseases	References
Atrial fibrillation	KEGG:H00731
Atrial fibrillation	KEGG:H00731
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R