• Gene id: 4628

Gene Summary

• Gene Symbol: MYH10   Gene   UCSC   Ensembl
• Aliases: NMMHC-IIB, NMMHCB
• Gene name: myosin heavy chain 10
• Alternate names: myosin-10, cellular myosin heavy chain, type B, myosin heavy chain, nonmuscle type B, myosin, heavy chain 10, non-muscle, myosin, heavy polypeptide 10, non-muscle, nonmuscle myosin II heavy chain-B, nonmuscle myosin heavy chain IIB,
• Gene location: 17p13.1 (28728787: 28743454)     Exons: 15     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the myosin superfamily. The protein represents a conventional non-muscle myosin; it should not be confused with the unconventional myosin-10 (MYO10). Myosins are actin-dependent motor proteins with diverse functions including
• OMIM: 160776

Protein Summary

• Protein general information: P35580  
  • Name: Myosin 10 (Cellular myosin heavy chain, type B) (Myosin heavy chain 10) (Myosin heavy chain, non muscle IIb) (Non muscle myosin heavy chain B) (NMMHC B) (Non muscle myosin heavy chain IIb) (NMMHC II b) (NMMHC IIB)
  • Length: 1976  
  • Mass: 228999
  • Tissue specificity: Isoform 1 is expressed in cerebellum and spinal chord. Isoform 2 is expressed in cerebrum and retina. Isoform 3 is expressed in the cerebrum and to a much lower extent in cerebellum. {ECO
• Sequence:

  MAQRTGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAMVNKDD
  IQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEM
  PPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRKDHNIPGELERQLLQANPIL
  ESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLL
  LEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPEN
  TVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQ
  GASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERP
  ANPPGVLALLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLN
  DNVATLLHQSSDRFVAELWKDVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNF
  VRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERM
  IRALELDPNLYRIGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAA
  YLKLRHWQWWRVFTKVKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAET
  ELFAEAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVT
  AEAKIKKMEEEILLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTR
  QELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEEELQGALARGDDETLHKNNALKVVRELQAQIAELQE
  DFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETKNHEAQIQDMRQR
  HATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLR
  VELAEKASKLQNELDNVSTLLEEAEKKGIKFAKDAASLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQE
  QQEEEEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKDAEALSQRLEEKALAYDKLEKTKNRL
  QQELDDLTVDLDHQRQVASNLEKKQKKFDQLLAEEKSISARYAEERDRAEAEAREKETKALSLARALEEALEAKE
  EFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQ
  FERDLQTRDEQNEEKKRLLIKQVRELEAELEDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQLRKL
  QAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAEQERDELADEITNSASGKS
  ALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAK
  LQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKA
  NARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEG
  ASLELSDDDTESKTSDVNETQPPQSE

• Structural information:
  • Protein Domains: (31..8-)
    SH3-like (/note="Myosin-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01190-)
    (85..78-)
    (/note="Myosin-motor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00782-)
    (786..81-)
    (/note="IQ-)
    (/evidence="ECO:0000255|PROSITE--)
  • Interpro: IPR000048  IPR036961  IPR001609  IPR027401  IPR004009   IPR008989  IPR002928  IPR027417  
  • Prosite: PS50096 PS51456 PS51844
  • PDB: 4PD3
  • PDBsum: 4PD3
  • DIP: 31110
  • STRING: ENSP00000353590
• Other Databases: GeneCards:  MYH10  Malacards:  MYH10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003774	motor activity	IEA	molecular function
GO:0051015	actin filament binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016459	myosin complex	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0008360	regulation of cell shape	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0016459	myosin complex	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0051015	actin filament binding	IDA	molecular function
GO:0030048	actin filament-based movement	IDA	biological process
GO:0000146	microfilament motor activity	IDA	molecular function
GO:0043531	ADP binding	IDA	molecular function
GO:0030898	actin-dependent ATPase activity	IDA	molecular function
GO:0005524	ATP binding	IDA	molecular function
GO:0001725	stress fiber	IDA	cellular component
GO:0000281	mitotic cytokinesis	IDA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0000281	mitotic cytokinesis	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0001725	stress fiber	IEA	cellular component
GO:0001778	plasma membrane repair	IEA	biological process
GO:0003279	cardiac septum development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005903	brush border	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0006930	substrate-dependent cell migration, cell extension	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0007512	adult heart development	IEA	biological process
GO:0008283	cell population proliferation	IEA	biological process
GO:0016459	myosin complex	IEA	cellular component
GO:0021670	lateral ventricle development	IEA	biological process
GO:0030239	myofibril assembly	IEA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0031594	neuromuscular junction	IEA	cellular component
GO:0035904	aorta development	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0098885	modification of postsynaptic actin cytoskeleton	IEA	biological process
GO:0001764	neuron migration	IEA	biological process
GO:0005938	cell cortex	IEA	cellular component
GO:0007097	nuclear migration	IEA	biological process
GO:0008360	regulation of cell shape	IEA	biological process
GO:0016460	myosin II complex	IEA	cellular component
GO:0021592	fourth ventricle development	IEA	biological process
GO:0021678	third ventricle development	IEA	biological process
GO:0021680	cerebellar Purkinje cell layer development	IEA	biological process
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0031175	neuron projection development	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0050885	neuromuscular process controlling balance	IEA	biological process
GO:0055003	cardiac myofibril assembly	IEA	biological process
GO:0055015	ventricular cardiac muscle cell development	IEA	biological process
GO:0060041	retina development in camera-type eye	IEA	biological process
GO:0060976	coronary vasculature development	IEA	biological process
GO:0098974	postsynaptic actin cytoskeleton organization	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0042641	actomyosin	IDA	cellular component
GO:0016460	myosin II complex	IDA	cellular component
GO:0035613	RNA stem-loop binding	IDA	molecular function
GO:0097513	myosin II filament	IDA	cellular component
GO:0048027	mRNA 5'-UTR binding	IDA	molecular function
GO:0030496	midbody	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005938	cell cortex	IDA	cellular component
GO:0032154	cleavage furrow	IDA	cellular component
GO:0032154	cleavage furrow	IDA	cellular component
GO:0001725	stress fiber	IDA	cellular component
GO:0031032	actomyosin structure organization	IMP	biological process
GO:0005829	cytosol	IMP	cellular component
GO:0030898	actin-dependent ATPase activity	IMP	contributes to
GO:0016887	ATPase activity	IMP	molecular function
GO:0005634	nucleus	HDA	cellular component
GO:0005844	polysome	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0051015	actin filament binding	IMP	contributes to
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003779	actin binding	NAS	molecular function
GO:0050714	positive regulation of protein secretion	IMP	biological process
GO:0016459	myosin complex	NAS	cellular component
GO:0005524	ATP binding	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04810	Regulation of actin cytoskeleton
hsa05132	Salmonella infection
hsa05130	Pathogenic Escherichia coli infection
hsa04530	Tight junction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq