• Gene id: 4616

Gene Summary

• Gene Symbol: GADD45B   Gene   UCSC   Ensembl
• Aliases: GADD45BETA, MYD118
• Gene name: growth arrest and DNA damage inducible beta
• Alternate names: growth arrest and DNA damage-inducible protein GADD45 beta, myeloid differentiation primary response protein MyD118, negative growth regulatory protein MyD118,
• Gene location: 19p13.3 (2476126: 2478258)     Exons: 4     NC_000019.10
• Gene summary(Entrez): This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p
• OMIM: 604948

Protein Summary

• Protein general information: O75293  
  • Name: Growth arrest and DNA damage inducible protein GADD45 beta (Myeloid differentiation primary response protein MyD118) (Negative growth regulatory protein MyD118)
  • Length: 160  
  • Mass: 17818
• Sequence:

  MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHF
  TLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQ
  WVPYISLQER

• Structural information:
  • Interpro: IPR024824  IPR029064  IPR004038  
  • DIP: 24219
  • STRING: ENSP00000215631
• Other Databases: GeneCards:  GADD45B  Malacards:  GADD45B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051726	regulation of cell cycle	IBA	biological process
GO:0000185	activation of MAPKKK activity	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0000186	activation of MAPKK activity	IEA	biological process
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:1900745	positive regulation of p38MAPK cascade	IDA	biological process
GO:0000185	activation of MAPKKK activity	IDA	biological process
GO:0046330	positive regulation of JNK cascade	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04010	MAPK signaling pathway
hsa05169	Epstein-Barr virus infection
hsa05202	Transcriptional misregulation in cancer
hsa05225	Hepatocellular carcinoma
hsa05226	Gastric cancer
hsa04218	Cellular senescence
hsa05224	Breast cancer
hsa04110	Cell cycle
hsa04210	Apoptosis
hsa04068	FoxO signaling pathway
hsa04064	NF-kappa B signaling pathway
hsa05222	Small cell lung cancer
hsa05210	Colorectal cancer
hsa05220	Chronic myeloid leukemia
hsa05217	Basal cell carcinoma
hsa05214	Glioma
hsa05212	Pancreatic cancer
hsa05218	Melanoma
hsa04115	p53 signaling pathway
hsa05223	Non-small cell lung cancer
hsa05213	Endometrial cancer
hsa05216	Thyroid cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospadias	MIK: 17437852
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17437852	Hypospadias			2 (1 case, 1 control)	Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881