• Gene id: 4613

Gene Summary

• Gene Symbol: MYCN   Gene   UCSC   Ensembl
• Aliases: MODED, N-myc, NMYC, ODED, bHLHe37
• Gene name: MYCN proto-oncogene, bHLH transcription factor
• Alternate names: N-myc proto-oncogene protein, class E basic helix-loop-helix protein 37, neuroblastoma MYC oncogene, neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene, oncogene NMYC, v-myc avian myelocytomatosis viral oncogene neuroblastoma derive,
• Gene location: 2p24.3 (15940437: 15947006)     Exons: 3     NC_000002.12
• Gene summary(Entrez): This gene is a member of the MYC family and encodes a protein with a basic helix-loop-helix (bHLH) domain. This protein is located in the nucleus and must dimerize with another bHLH protein in order to bind DNA. Amplification of this gene is associated wi
• OMIM: 164840

Protein Summary

• Protein general information: P04198  
  • Name: N myc proto oncogene protein (Class E basic helix loop helix protein 37) (bHLHe37)
  • Length: 464  
  • Mass: 49,561
• Sequence:

  MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEHSSEPP
  SWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGFSAREKLERAVSEKLQHGRGPPTAGSTAQSP
  GAGAASPAGRGHGGAAGAGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGI
  AAPAGAPGVAPPRPGGRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT
  VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLKSVIPPKAKSLSPRNS
  DSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQLLLEKEKLQAR
  QQQLLKKIEHARTC

• Structural information:
  • Protein Domains: bHLH. (381-433)
  • Interpro: IPR011598  IPR036638  IPR002418  IPR012682  
  • Prosite: PS50888
  • CDD: cd00083
  • PDB: 5G1X
  • PDBsum: 5G1X
  • DIP: 36822
  • STRING: ENSP00000281043
• Other Databases: GeneCards:  MYCN  Malacards:  MYCN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000785	chromatin	TAS	cellular component
GO:0001502	cartilage condensation	IEA	biological process
GO:0002053	positive regulation of mesenchymal cell proliferation	IEA	biological process
GO:0003677	DNA binding	TAS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006357	regulation of transcription from RNA polymerase II promoter	TAS	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010942	positive regulation of cell death	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0042733	embryonic digit morphogenesis	IEA	biological process
GO:0045607	regulation of auditory receptor cell differentiation	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0048704	embryonic skeletal system morphogenesis	IEA	biological process
GO:0048712	negative regulation of astrocyte differentiation	IEA	biological process
GO:0048754	branching morphogenesis of an epithelial tube	IEA	biological process
GO:2000378	negative regulation of reactive oxygen species metabolic process	IEA	biological process
GO:0000785	chromatin	TAS	cellular component
GO:0001502	cartilage condensation	IEA	biological process
GO:0002053	positive regulation of mesenchymal cell proliferation	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006357	regulation of transcription from RNA polymerase II promoter	TAS	biological process
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010942	positive regulation of cell death	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0042733	embryonic digit morphogenesis	IEA	biological process
GO:0045607	regulation of auditory receptor cell differentiation	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0048704	embryonic skeletal system morphogenesis	IEA	biological process
GO:0048712	negative regulation of astrocyte differentiation	IEA	biological process
GO:0048754	branching morphogenesis of an epithelial tube	IEA	biological process
GO:2000378	negative regulation of reactive oxygen species metabolic process	IEA	biological process
GO:0000785	chromatin	TAS	cellular component
GO:0003677	DNA binding	TAS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0006357	regulation of transcription from RNA polymerase II promoter	TAS	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa03050	Proteasome
hsa05202	Transcriptional misregulation in cancer

Diseases

Associated diseases	References
Neuroblastoma	KEGG: H00043
Cancer (kidney)	GAD: 20332316
Carotid artery diseases	GAD: 17903303
Male factor infertility	MIK: 22771312
Feingold syndrome 1	OMIM: 164840
Male infertility	MIK: 22771312
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
22771312	Male infertility				Male infertility	TGF-?1 MYC MYCN and TP53
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)