• Gene id: 4610

Gene Summary

• Gene Symbol: MYCL   Gene   UCSC   Ensembl
• Aliases: L-Myc, LMYC, MYCL1, bHLHe38
• Gene name: MYCL proto-oncogene, bHLH transcription factor
• Alternate names: protein L-Myc, class E basic helix-loop-helix protein 38, l-myc-1 proto-oncogene, myc-related gene from lung cancer, protein L-Myc-1, v-myc avian myelocytomatosis viral oncogene lung carcinoma derived homolog, v-myc myelocytomatosis viral oncogene homolog 1, lu,
• Gene location: 1p34.2 (39901916: 39895427)     Exons: 2     NC_000001.11
• OMIM: 610417

Protein Summary

• Protein general information: P12524  
  • Name: Protein L Myc (Class E basic helix loop helix protein 38) (bHLHe38) (Protein L Myc 1) (V myc myelocytomatosis viral oncogene homolog)
  • Length: 364  
  • Mass: 40327
• Sequence:

  MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAES
  RGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGE
  PKTQACSGSESPSDSENEEIDVVTVEKRQSLGIRKPVTITVRADPLDPCMKHFHISIHQQQHNYAARFPPESCSQ
  EEASERGPQEEVLERDAAGEKEDEEDEEIVSPPPVESEAAQSCHPKPVSSDTEDVTKRKNHNFLERKRRNDLRSR
  FLALRDQVPTLASCSKAPKVVILSKALEYLQALVGAEKRMATEKRQLRCRQQQLQKRIAYLTGY

• Structural information:
  • Protein Domains: (281..33-)
    (/note="bHLH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00981"-)
  • Interpro: IPR011598  IPR036638  IPR002418  IPR012682  
  • Prosite: PS50888
  • CDD: cd00083
  • STRING: ENSP00000380494
• Other Databases: GeneCards:  MYCL  Malacards:  MYCL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0042025	host cell nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0045607	regulation of inner ear auditory receptor cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003677	DNA binding	TAS	molecular function
GO:0003677	DNA binding	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881